KEGG   Zea mays (maize): 100283121Help
Entry
100283121         CDS       T01088                                 

Gene name
pco133201
Definition
LOC100283121
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 369 aa AA seqDB search
MAMMVDPPNGMASQGKHYYTMWQTLFEIDTKYVPIKPIGRGAYGIVCSSVNRETNEKVAI
KKINNVFDNRVDALRTLRELKLLRHLRHENVIALKDIMMPAHRRSFKDVYLVYELMDTDL
HQIIKSSQPLSNDHCQYFLFQLLRGLKYLHSAGILHRDLKPGNLLVNANCDLKICDFGLA
RTNNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIVNVLGTMGEADLAFIDNPKARKYIKSLPYAPGAPFTGMYPQAHPLAIDLLQKML
VFDPSKRISVTEALEHPYMSPLYDPSANPPAQVPIDLDIDENLGVDMIREMMWQEMIHYH
PEVLTRISM
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgatggtggatccccccaatggcatggcaagtcaaggaaagcattactatact
atgtggcagacactgtttgagatcgacaccaagtacgtgccgatcaagcccatcggaaga
ggagcttacggaatcgtttgctcatctgttaaccgcgagaccaatgaaaaagtcgcgata
aaaaagataaacaacgtctttgacaaccgtgtggatgcgctaaggacgctgagagagctg
aaactccttcggcacctgaggcacgagaatgttattgctctcaaggacataatgatgcct
gcgcatagaaggagcttcaaggacgtttacttggtttatgagctcatggacactgatctg
catcaaataattaagtcatctcaaccactatccaatgaccactgccagtatttccttttt
cagctgctccgaggcctgaagtacctccattcagccgggatactccacagagacctaaag
ccagggaacctcctggtcaacgcaaactgtgacctgaagatatgcgacttcgggctcgcc
cgcacgaacaacaccaagggccagttcatgacggagtacgtggtgacccgctggtacagg
gcacccgagctgctgctctgctgcgacaactacggcacgtccattgacgtctggtctgtg
gggtgcatattcgcggagctgcttggccgcaagccgatcttcccaggaaccgagtgcctg
aaccagctcaagctcatcgtcaacgtcctcggcaccatgggcgaggccgacctcgcgttc
atcgacaacccgaaggcccgcaagtacatcaagtcccttccgtacgccccgggcgccccc
ttcaccggcatgtaccctcaggcgcaccctctcgccatcgacctgctgcagaagatgctc
gtgttcgacccgtccaagaggatcagcgtcaccgaggcgctggagcacccgtacatgtct
ccgctctatgacccgagcgcgaaccctcccgcgcaggtgccgatcgacctcgacatcgac
gagaacctcggcgtcgacatgatcagggagatgatgtggcaggagatgatccactaccac
cccgaggtcctcacgagaatcagcatgtga

DBGET integrated database retrieval system