KEGG   Zea mays (maize): 100283171Help
Entry
100283171         CDS       T01088                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100283171
   00052 Galactose metabolism
    100283171
Enzymes [BR:zma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100283171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 367 aa AA seqDB search
MAGAKRGILLVLCLAVVLVALGSGGVEARKRGKQSLGFYELRRGEFSMVVTNWGATILSV
RLPDKNGHIDDVVLGYKNIGSYVNDTTYFGALVGRVANRIAGGRFTIRDHAYHTYRNDGN
NTLHGGHRGFNQVFWSVRERVTGEFPHITFAYRSYDGEQGFPGNLDVLVTYKIDGDCSYS
VTMYARPLDKPTPVNLAQHTYWNLRGHGNGTVLRHAVQIFASAVTPVGRGLIPTGAVTPV
AGTPFXFRAXSAPGAHIAEVEGGYDINXVLDGETDGQGVRKVAVVSEADSGRVMELWADQ
PGLQFYTGNMLKGDEGKGGAVYPKYAGMCLETQDYPDAVHEPAFPAEVYRPGQLYKHYML
YKFSISK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggctggagccaagagaggaatcctgctcgtcctgtgcctggccgtcgtcttggtggcg
ctcgggagtggcggcgtggaggcgaggaagcgagggaagcagtccctggggttctacgag
ctgcgtcggggcgagttctccatggtcgtcaccaactggggcgccaccatcctctccgtc
aggctccccgataagaacgggcacatcgacgacgtcgttcttggctacaagaacatcgga
tcgtacgtcaacgacacgacctacttcggcgcgctggtggggcgcgtggcgaaccgcatc
gccggcgggcggttcaccatcagggaccacgcctaccacacgtatcggaacgacggcaac
aacacgctccacggcggccaccgcgggttcaaccaggtgttctggtccgtccgggagcgc
gtcacgggggagttcccgcacatcaccttcgcctaccgcagctacgacggcgagcaaggg
ttcccgggcaacctggacgtgctggtcacctacaagatcgacggcgactgctcgtacagc
gtcaccatgtacgcgcggccgctggacaagcccacccccgtgaacctggcgcagcacacg
tactggaacctccgcggccacggcaacggcaccgtcctgcgccacgccgtccagatcttc
gcgtccgcggtcacgcccgtgggccgcggcctcatcccgacgggcgcggtcaccccmgtc
gccggcactccgttysasttccgcgccmsgtcggcgcccggcgcgcacatcgccgaggtc
gagggtgggtacgacatcaacwacgtgctggacggcgagacggacgggcaaggcgtgcgc
aaggtggccgtggtcagcgaggcggactccgggcgcgtcatggagctktgggccgaccag
ccgggcctgcagttctacactggcaacatgcttaagggcgacgagggcaagggcggcgcc
gtctaccccaaatacgctgggatgtgcctggagacgcaagactacccggacgccgtgcac
gagccggccttcccggccgaggtgtaccgccctggccaactctacaagcactacatgctc
tacaagttctcaatcagcaagtag

DBGET integrated database retrieval system