KEGG   Zea mays (maize): 100283183Help
Entry
100283183         CDS       T01088                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
zma  Zea mays (maize)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100283183
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100283183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 364 aa AA seqDB search
MAQARVRLTPAGRTPAATFLSGSNPRPAHLTFFPKLTPTSLSAAAAANAPPPHIVVVGSA
NADIYVEVDRLPLIGETVAARAGRSLAGGKGANQAACGGRLALGPTYLVARVGDDANGRL
LEGALADAGGVRTDRVARAADAPSGHAVVMLMPDGQNSIIIVGGANMEGWAAGIGSEDLE
LIRKAGVLLLQREIPDWVNAQAAQAAKSAGVPVIMDAGGMDTPLPRELLSLVDIFSPNET
ELARLTGMPTETFEQISMAAGKCHKMGVQEVLVKLGSQGSALFVEGEEPIRQPIVPATEV
IDTTGAGDTFTSAFAVALVEGKPKRECMRFAAAAASLCVRVKGAIPSMPDRKSVMKLLES
VGVE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggcacgcgtgcgccttactccggccggccgcacgccggccgccacgttcctc
tcgggctccaaccccagacccgcccacctcaccttcttcccgaagcttacccctacctcc
ctctccgccgccgcagctgccaatgcgccgccgccccacatcgtcgtcgtgggctccgcc
aacgccgacatctacgtcgaggtcgaccgtctcccgctcatcggcgagaccgtggcggcc
cgcgcgggacgcagcctcgcgggcggcaagggcgccaaccaggccgcctgcggtggccga
cttgcgctgggccctacctacctcgtggcgcgcgtgggggatgacgccaacggccgactc
ctagagggcgccctagccgacgccggtggtgtccgcaccgaccgcgtcgcacgcgcggcc
gatgcgccatcgggacacgccgtcgtcatgctcatgcccgacgggcagaactccattatc
atcgtgggcggggcgaacatggagggctgggcggcggggatcggttcggaggacctggaa
ttgatccgaaaggcaggcgtgctgctgctgcagagggagatacccgattgggtcaacgcg
caggctgcccaggctgcaaaaagtgcaggagtgcctgttatcatggatgctggtggaatg
gatactcctttacctcgagaactactcagtctagtggatattttcagtccaaatgaaaca
gagctagcgcgtctgactgggatgcctactgagacgtttgaacagatcagcatggctgca
ggaaaatgccataaaatgggtgtgcaagaagtactagttaaacttggatcacaaggatct
gctttgttcgtcgagggagaggagccaatcaggcagccgatagttcccgccacagaagtc
attgacaccacgggggctggtgacacattcacctcagcgttcgctgtagccctggtcgag
gggaagcctaagagggagtgcatgagatttgctgctgctgccgcctctctgtgtgttcga
gtaaagggggctatacccagcatgcctgacagaaaatcggtgatgaagcttctggaatct
gtgggagtcgaatag

DBGET integrated database retrieval system