KEGG   Zea mays (maize): 100283207Help
Entry
100283207         CDS       T01088                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
zma  Zea mays (maize)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:zma00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 293 aa AA seqDB search
MSMLLSRRFSCALARAPSLVRGRPLPPCAARTTPPAPSSPPRRLMSSSSAGWQHSSHRPP
PPPPPPPHPGADKDQLFRGLEAALGTAFSSEPLAPPPQPMILVISGPSGVGKDAVIKRLQ
EEREGIHFVVTATSRAMRPGEVEGKDYYFVSKEEFLTMIEREELLEYALVYGEYKGIPKQ
QIRDYMAKGCDIVLRVDIQGAATLRQILGESAVFIFLVAESEEALVKRLIHRKTETSDML
LVRVATAREEVKHMKNFDYVVVNAQGKLEEAVKQVESIIDAEKSKIHKRHVNI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgcttctctcgcgaaggttctcctgcgccctcgcccgcgccccgtcgctcgta
cggggccggccccttcctccctgcgccgcccgcaccacccctccggctcccagctctccg
ccccgccgcctcatgtcgtcctcctctgccgggtggcagcactcctcgcaccgtcccccg
ccgccgccgccgcctcctcctcatcccggtgctgacaaggaccagctgttcagggggctg
gaggcggcgctgggcaccgcgttcagctccgagccgctggcgccgccaccgcagcctatg
atcctcgtcatcagcgggcccagcggtgtcggcaaggacgccgtcatcaagaggctgcag
gaggagagggaagggatccatttcgttgtcaccgcgacaagcagggcgatgaggccaggt
gaagttgaagggaaagactattactttgtcagtaaggaggaatttctgacgatgattgag
agggaggagttgctcgagtatgctcttgtttatggggagtacaaggggatccccaaacag
cagattcgtgactacatggctaaaggctgtgacattgttctgagagtggacattcaagga
gcagcgacgttaagacagatacttggtgaatctgcggttttcatatttttagttgctgag
agtgaagaggcacttgttaaaaggctaatccaccgtaaaacagaaacatcagatatgctt
cttgtcagagttgcaacagccagggaggaggtgaaacacatgaagaatttcgactatgtg
gttgtaaacgctcaagggaaacttgaggaggctgttaaacaagtggaatctatcattgat
gctgagaagtctaaaattcacaagcggcatgtcaatatctaa

DBGET integrated database retrieval system