KEGG   Zea mays (maize): 100283214Help
Entry
100283214         CDS       T01088                                 

Definition
eukaryotic translation initiation factor 4E-1
Orthology
K03259  
translation initiation factor 4E
Organism
zma  Zea mays (maize)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100283214
Translation factors [BR:zma03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100283214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 220 aa AA seqDB search
MADEIDTRPAPAGSRGRPAHATEDDDREEGEIATDAPSPALPAAHPLEHSWTFWFDNPHG
KNKMAAWGSSIRPIHTFSTVEDFWGLYNNIHHPSKLIGGADFHCFKNKIEPKWEDPICAN
GGKWTISCGRGKSDTLWLHTLLAMIGEQFDYGDEICGAVVSVRSKQERIAIWTKNAANEA
AQISIGKQWKEFLDYKDSIGFIVHDDAKKMDKGLKNRYTV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgagattgacacgaggccggctcccgcgggctcccgcggccgtcctgcgcac
gctaccgaggacgacgacagggaggagggcgagatcgccaccgacgccccctcgcccgcc
ctccccgccgcgcacccgctcgagcactcgtggaccttctggttcgacaacccgcacggc
aagaacaagatggccgcctgggggagctccatacgacccatccacaccttctccaccgta
gaggacttctggggcctctacaataatatccatcaccctagcaagttgatcggcggagct
gacttccattgcttcaagaacaagattgagccaaaatgggaagatcctatttgtgctaat
ggcggtaaatggaccatcagctgtggaagaggaaaatctgacacgctttggctgcacacc
ctgttggctatgatcggcgaacaattcgactatggtgatgaaatttgtggagcagtggtc
agcgtgcgtagcaagcaggaaagaatagctatctggacaaaaaatgctgctaatgaagct
gctcagataagcatcgggaagcagtggaaggaatttctggattacaaggactccattgga
ttcattgttcatgacgatgcaaagaagatggacaagggactgaagaaccgttacacggtt
tga

DBGET integrated database retrieval system