KEGG   Zea mays (maize): 100283257Help
Entry
100283257         CDS       T01088                                 

Gene name
pco114914
Definition
LOC100283257 (EC:1.11.1.12)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
zma  Zea mays (maize)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100283257 (pco114914)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100283257 (pco114914)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100283257 (pco114914)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 170 aa AA seqDB search
MGAAESVPETSIHEFTVKDCNGKEVSLETYKGKVLLVVNVASKCGFTETNYTQLTELYQK
YRDKDFEILAFPCNQFLRQEPGTDQQIQDFACTRFKAEYPVFQKVRVNGPDAAPVYKFLK
ASKPGLFGSSRIKWNFTKFLVDKDGKVIERYGTSTAPMAIEKDIQKALEE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggggcggccgaatccgtgccggagacctccatacacgaattcaccgtcaaggattgc
aacggcaaggaagtgagcctggaaacctacaaggggaaggtcctccttgttgttaacgtc
gcctccaaatgtgggttcacggagaccaattacacgcagctgacggagctttatcagaag
tacagggacaaagacttcgagatattggcattcccttgcaatcagttcttgcgacaggag
ccaggtactgatcagcagatacaagactttgcttgcaccagatttaaagctgaataccca
gtttttcagaaggtgcgcgtaaacggaccagatgcggcgccggtttacaagtttctgaaa
gctagcaagcctggtttgtttgggtcatcaaggatcaaatggaactttaccaagtttctg
gtggacaaagatgggaaggtcatcgagagatacggaacctcgacagctccaatggcaatt
gagaaggacatccagaaggcccttgaggaataa

DBGET integrated database retrieval system