KEGG   Zea mays (maize): 100283402Help
Entry
100283402         CDS       T01088                                 

Definition
eukaryotic translation initiation factor 3 subunit 1 alpha, 35kDa
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
zma  Zea mays (maize)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100283402
Translation factors [BR:zma03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100283402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 231 aa AA seqDB search
MEDWDSEDFQPVAPVVKVEPLKNQWADEDVDADDVKDSWEEEEEEEKPKPAVVQKNATKP
SAKAPAKKGKQQASTSAEEPDEPLSPTSEKIRQQRLVEEADFKSTTDLFAKKSGEQKSLD
TFIPKSESDFAEYAELIANKLLPYDKSFHYMALLKNVMRLSMTPLKGSDAKDISSSVTAI
ANEKIKAEKEAAAGKKKQGARKKQLHIEKGDDDFIPGRGGGYDDPDEYDFM
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaggattgggattctgaagatttccagcccgttgctcctgttgtgaaagtcgagcca
cttaaaaatcagtgggctgatgaagatgtcgatgccgacgacgtaaaagattcatgggag
gaagaagaggaagaggagaaacctaagccagcggttgtgcaaaagaacgcgacgaaacct
agcgctaaggctcctgctaaaaagggaaaacagcaagcatcaacaagtgccgaggaacca
gacgagcctttgagtcccacttcagagaaaattcgccaacagaggcttgtggaagaagct
gacttcaagtcaactacagacctttttgcaaagaagagcggtgaacaaaagtcactagat
acttttatcccaaagtccgagagcgactttgcggaatatgcggagcttattgcaaataaa
ctgctcccctacgataaaagttttcactacatggctctcctcaagaatgtcatgagactt
tccatgacaccgttgaaaggctcggacgcgaaagacatatcttcctccgtgacggcgatt
gctaacgagaagatcaaggctgagaaagaggccgcagcaggcaaaaagaaacaaggagcg
agaaagaagcagctccacatcgagaaaggagacgacgacttcatccccggacggggtggt
ggctacgatgacccggacgagtacgacttcatgtga

DBGET integrated database retrieval system