KEGG   Zea mays (maize): 100283443Help
Entry
100283443         CDS       T01088                                 

Definition
steroid reductase DET2
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
zma  Zea mays (maize)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    100283443
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100283443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 262 aa AA seqDB search
MPDQTSAAAAGGAAFDRCLLALYLISPLTVLALRFISAPYGKLSRPGWGPVLPAPLAWFL
MESPTLWLPPLVLLRWPPPPLSGPLAALPAALYAFHYVHRTLVHPLRLARLRRAPAPVPL
LIAACALGFNILNAYLQARSFALHAGRQASPFRCLAGLALFAWGMRTNIAADKELLRLKE
AGGGYKIPRGGWFDLVTSPNYFGETVEWLGFAVVAWTPAAWAFFLYTCANLGPRARDHRR
WYVQKFRGEYPASRKAFIPYIY
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaccagacgtcggctgcggccgcgggcggcgcggcgttcgaccgttgcctgctg
gcgctgtacctcatcagcccgctcactgttctggcgctccgcttcatctccgcgccgtac
ggcaagctatcccggccgggctggggccccgtcctaccggccccactcgcgtggttcctc
atggagagccccaccctctggctcccaccgctcgtcctcctccgctggccgccgccgccg
ctctccggcccactcgccgcactccccgccgcgctctacgcgttccactacgtccaccgc
acgctggtccacccgctccgcctcgcccgcctgcgccgcgccccggcccccgtgccgctc
ctcatcgccgcctgcgccttgggattcaatatcctcaacgcctacctacaggcccgctcc
ttcgccctccacgccggccgccaggcgtcccccttccgctgcctcgctgggctggccctc
ttcgcgtggggaatgcggacgaacatcgcggcggacaaggagctgctgcggctcaaggag
gccggaggcgggtacaagatcccgaggggcgggtggttcgacctcgtcaccagccccaat
tacttcggcgagacggtggagtggctgggcttcgccgtggtggcgtggacgcccgcggcc
tgggcgttcttcctctacacctgcgccaacctcgggccgagggccagggaccaccgccgc
tggtacgtgcagaagttccgcggcgagtacccggcgtcgcgcaaggcgttcatcccctac
atctactag

DBGET integrated database retrieval system