KEGG   Zea mays (maize): 100283483Help
Entry
100283483         CDS       T01088                                 

Gene name
pco103361
Definition
LOC100283483
Orthology
K06634  
cyclin H
Organism
zma  Zea mays (maize)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100283483 (pco103361)
  Replication and repair
   03420 Nucleotide excision repair
    100283483 (pco103361)
Transcription machinery [BR:zma03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100283483 (pco103361)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 329 aa AA seqDB search
MADFRTSTQRERWIFQSHDLMERWAAANQRAAQTLAQYGTTRLNVDLLDGSVSYPESMPD
HVEGSSVVKPLSYEEEQLTRVFYEQKIQEVCAAFKFPHKIQATAIIYFKRFYLQWSVMEH
QPKHIMLTCVYASCKVEENHVSAEELGKGIQQDHQIILNNEMILLKTLDFDLIVYAPYRS
IEGFIDDLEDFCRAGNGPFQRLKELRQAAISHVDKMMLTDAPLLYTPGQLALAALHKSND
LLRVVDFERYLEIIFSRQHSDCPIEQFVQSINEINYLVDQLNIPTVKDMRHVDRKLKHCW
DPSSHDEHNKKKEKKLKHKSKRTSTDAQL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttccggacctccacccaacgggagaggtggatcttccagtcgcacgatttg
atggagaggtgggcggcggcaaaccagcgggccgctcagacccttgcgcagtatgggacg
acccggcttaatgtggacctgcttgatggctcggtatcctacccagagtccatgccggat
catgttgagggtagctcggttgtaaagcctctttcttacgaagaggagcaattgacaagg
gtattttacgagcagaagattcaggaagtatgcgctgcattcaagttccctcacaaaatc
caggctacagcaataatatatttcaagagattctatctacaatggtctgtaatggagcat
caaccaaagcatattatgttaacatgtgtatatgcttcttgcaaagtggaagaaaaccat
gtttctgctgaggaacttggtaaaggaattcagcaggaccaccagatcattctaaataat
gagatgattcttcttaaaactttagattttgatctcattgtttatgctccatatcgatcg
attgaaggatttattgatgacctagaggatttctgcagggcaggtaatggtccattccag
cgtttgaaggagttgcgccaggctgctatatcccatgttgacaaaatgatgttgactgat
gcacctcttctctatacccctgggcagttggcactggcggctcttcacaagtctaatgat
cttctcagggtcgtcgattttgaaagatacttggaaattatcttctcaaggcaacattct
gattgtccaatcgaacagtttgttcagtcgatcaacgaaatcaattacttagtcgaccag
cttaatatacctactgtcaaagacatgagacacgtggaccgcaagctgaaacattgctgg
gatccaagctcacatgacgagcataacaagaagaaagaaaagaagttaaagcacaaatcg
aaaagaacatctaccgatgcccaactatag

DBGET integrated database retrieval system