KEGG   Zea mays (maize): 100283675Help
Entry
100283675         CDS       T01088                                 

Definition
rae1-like protein
Orthology
K14298  
mRNA export factor
Organism
zma  Zea mays (maize)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100283675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 343 aa AA seqDB search
MASLTGLTANPNPNKSFEILPNPGDSVSSLSFSPKSNLLVATSWDNQVRCWEIVGGNSQP
KASISHDQPVLCSAWKDDGTTVFSGGCDKQVKMWPLLSGGQPQTVAMHDAPVKEVAWIPQ
MNLLVSGSWDKTLRYWDTRQSNPVHIQQLPERCYALTVNYPLMIVGTADRHLVVFNLQNP
QTEFKRIQSPLKYQTRCLAAFPDQQGFLVGSIEGRVGVHHIDDAQQSKNFTFKCHREGND
IFSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAFSRCPLPIPCSTFNSDGSIFAY
AVCYDWSRGAENHNPAAAKTSIYLHSPQETEVKGKPRIATGRK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtctaaccggcctcaccgcgaaccctaatccgaacaagtcattcgagatactg
ccgaacccaggtgactctgtctccagcctcagctttagtcccaagagtaatctgcttgtg
gcaacctcctgggataaccaggtgaggtgctgggagattgttggtggtaacagtcagcca
aaggcgtccatttctcatgatcagccggttctctgctcggcttggaaggatgatggaact
actgtcttctctggaggctgtgacaagcaggtcaaaatgtggcctcttctgtcaggtggg
cagcctcagacggttgctatgcatgatgcccctgtcaaggaggtcgcctggattcctcag
atgaatcttcttgtatccggaagctgggataagactttaaggtactgggatacaaggcaa
tcaaatcctgtgcatattcagcaacttcctgaacgttgctatgctcttactgtgaattat
ccccttatgattgttggaactgctgaccgtcatcttgttgtcttcaatttgcagaatcct
cagacggagttcaagcgaatccaatcaccactaaaataccagacacggtgccttgctgca
ttccctgatcaacaagggtttttggttggttcaatagaaggaagagttggcgttcatcat
atcgatgacgcacagcaaagcaaaaacttcacattcaaatgccacagggaaggaaatgat
atattctctgtcaattcactcaacttccaccctgtccatcacacatttgcaactgctgga
tctgacggtgctttcaacttctgggataaggatagcaagcagaggctaaaggcttttagt
agatgcccccttcccattccttgcagtaccttcaacagtgatggttccatatttgcttat
gcggtttgctatgactggagccgtggggccgaaaatcacaaccctgcagctgcaaagaca
tccatctatctccacagtccacaggaaaccgaggtcaaaggaaagccgcgcattgcaaca
ggcaggaagtga

DBGET integrated database retrieval system