KEGG   Zea mays (maize): 100283686Help
Entry
100283686         CDS       T01088                                 

Definition
CHY1
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
zma  Zea mays (maize)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100283686
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100283686
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100283686
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100283686
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100283686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 419 aa AA seqDB search
MEGRRLSRQQLRSLPDAASFSPEVAASPGLVGSGQLGLGLSAAFETLPPILVEVNGFTRT
LILNRPKQLNALSSTMIMGLLRCFTAYEKDDGVKLLIMKGKGRAFCAGGDVAAVVRSIHK
DSWKYGADFFRNEFLLNYIIATYTKPQVSLLSGIVMGGGAGVSLHGRFRVATDNTVFAMP
ETALGLFPDIGASYFLSRLPGFYGEYVGLAGARLDGGEMLACGLATHFVQSNSLLSLEES
LKKVDTSNAFAVCGIIDQFAQQPSLKESSSLNRLEIINKCFSKRTVEEIISALEVEASNS
ADEWVATTIQSLKKASPTSLKISLRSIREGRTQTVGECLQREYRMVCHVMRGDFSRDFFE
GCRAILLDKDRNPKWMPPRLEQVHDEAVEQYFSRIDDPQWEDLNLPARRSHGRNIESKL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggaggggagacggctttcacgccagcagttgcgctcgctaccggacgccgcgtccttc
tcgccggaagtcgcggccagcccggggctcgtcggctccggccagttgggtctcggtctc
tcggcggcgttcgagactctgccgccgattttggtagaagtgaatggctttacaaggaca
ctgattttgaataggccaaagcagttaaatgcactctcctcgaccatgattatgggactc
ttgaggtgtttcactgcttatgagaaagacgatggagttaaattgttgattatgaagggt
aaaggaagagcattttgtgctggaggtgatgttgctgcagttgttcgatctatacataaa
gacagctggaaatatggtgctgatttcttccgaaatgaatttttgttgaattacataatt
gcaacttataccaaacctcaggtttctcttcttagtggaatcgtcatgggtggaggtgct
ggcgtttctttacatggaaggtttagagttgccaccgataacacggtttttgcaatgcca
gaaacagctctgggtctctttccagatataggggcctcatattttctgtctcggcttcct
ggattctatggagagtatgttggtcttgctggtgccagattggatggtggggaaatgctt
gcatgtggtctggcaactcattttgtccagtcaaatagtctgctatcgctggaagaatca
cttaaaaaggtggatacttccaatgcttttgcagtgtgtggtatcatcgatcaatttgct
caacaaccatcactgaaagaaagcagctctttgaataggttggaaatcatcaacaaatgc
ttttccaaaaggacagtcgaagaaattatatccgctcttgaagtagaggcctcaaattcg
gcagatgaatgggttgctacaacaatccagtccttgaagaaggcttctcctaccagtctg
aaaatctctctgagatcgataagagaagggaggacacaaactgttggggagtgcttgcag
cgggaatatagaatggtctgccatgtcatgcgtggtgacttcagcagagacttctttgag
ggatgcagggctatattgctagataaagatcgaaacccaaagtggatgcctccaaggttg
gaacaagtgcatgatgaggctgttgaacagtatttctccagaattgatgatccacagtgg
gaagacttgaacctacctgctagacgctcccacggaagaaatatcgagtccaagctttga

DBGET integrated database retrieval system