KEGG   Zea mays (maize): 100283844Help
Entry
100283844         CDS       T01088                                 

Gene name
umc2288
Definition
LOC100283844
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
zma  Zea mays (maize)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100283844 (umc2288)
Translation factors [BR:zma03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100283844 (umc2288)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 232 aa AA seqDB search
MEDWDSEEFQPVVPVVKAEPLKNQWADEDVEEDDVKESWEEEEEEEKPKPAPVEKVAAKP
STKAPAKKGKQQALTSAEEPDEPPLSPTSQKIRQQRLVEEADFKSTTELFAKKGSEQKSL
DTFIPKSKSDFAEYAELIANKLRPYEKSFHYMALLKNVMRLSMTSLKGADAKDISSSVTA
IANEKIKAEKEAAAGKKKQGAKKKQLHIEKGDDDFIPGRGGGYDDPDEYDFM
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggaggactgggattctgaagaattccagccagttgtgcctgttgtgaaagccgagcca
cttaaaaatcagtgggctgatgaagatgttgaagaagatgatgtaaaagaatcatgggaa
gaagaggaggaggaggagaaacctaagccagcgccagtggaaaaggtcgctgcaaaacct
agcactaaggctcctgctaaaaagggaaaacaacaagcattgacaagtgctgaagaacca
gatgagcctcctcttagtcccacttcacagaaaattcgccaacaaagacttgtggaagaa
gctgacttcaagtcgaccaccgagctttttgcaaagaagggcagtgagcaaaagtcacta
gatacttttattccaaagtccaagagtgactttgcggaatacgcggagcttattgcaaac
aaactacgcccctatgagaaaagctttcactacatggctctgcttaagaatgtcatgaga
ctttccatgacatcgttgaaaggtgcggacgccaaagatatatcttcttccgtgacggca
attgctaacgagaagatcaaggctgagaaggaggctgcagcaggcaaaaagaaacaagga
gcgaaaaagaagcaactccacatcgagaaaggagacgacgacttcatccccggccggggt
ggtggctacgatgaccccgatgagtacgacttcatgtga

DBGET integrated database retrieval system