KEGG   Zea mays (maize): 100283889Help
Entry
100283889         CDS       T01088                                 

Definition
pyruvate dehydrogenase E1 component alpha subunit
Orthology
K00161  
pyruvate dehydrogenase E1 component subunit alpha [EC:1.2.4.1]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:zma01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:zma00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:zma00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:zma00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 390 aa AA seqDB search
MAAAALLRRIPAARAPATAFMAARPVSDSTAALTIETSVPFTSHLVDPPSRDVTTTPAEL
VTFFRDMSLMRRMEIAADSLYKAKLIRGFCHLYDGQEAVAVGMEAAITRSDSIITAYRDH
CTYLARGGDLVSAFSELMGREGGCSRGKGGSMHFYKKDANFYGGHGIVGAQVPLGCGLAF
AQKYKKEETATFALYGDGAANQGQLFEALNISALWKLPAILVCENNHYGMGTAEWRAAKS
PAYYKRGDYVPGLKVDGMDVLAVKQACKFAKDHAVANGPIVLEMDTYRYHGHSMSDPGST
YRTRDEISGVRQERDPIERVRKLLLAHDLATAAELKDMEKEIRKQVDDAIAKAKESSMPD
TSELFTNVYKKGFNVESFGPDRKELRATLP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccgcgctccttcgccgcatccccgccgcgcgggccccggccacggccttc
atggcggcgcgcccggtctccgattccacggcggcgctcaccatcgagacatctgtccct
ttcacctcccacctcgtcgacccgccctcgcgcgatgtcaccaccacccccgccgagctc
gtcaccttcttccgcgacatgtccctcatgcgccgcatggagatcgctgccgactccctc
tataaggccaagctcatccgcgggttctgccacctctacgacggccaggaggccgtcgcc
gtagggatggaggccgccatcacccgctccgattccatcatcaccgcctaccgcgaccac
tgtacctacctcgcccgcggaggggacctcgtctccgccttctccgagctgatgggccgc
gagggcggctgctcccgcgggaagggcggatccatgcatttctataagaaggatgccaat
ttctacggcgggcacggcatcgtcggcgcgcaggtgcccctcggatgcggcctcgccttc
gctcagaagtacaagaaggaggagacggccacgtttgccctctatggtgacggtgcggct
aaccagggacagctctttgaggctctcaacatttcggccctctggaagctgcccgccata
ttggtttgcgagaacaaccattatggtatgggaacagcggaatggagggcagcgaagagt
cctgcttactacaagcgtggcgactatgtgcctggattgaaggttgatggaatggatgtt
cttgctgtgaagcaagcgtgcaaatttgcaaaagatcatgctgttgcaaatggcccaatt
gtccttgagatggatacctacaggtaccatggccactctatgtcagatccaggaagcact
taccgcaccagggatgagatttcaggtgtcaggcaggaacgggacccaattgaaagggtt
agaaagttgcttttggctcacgacttggcaactgctgctgagctcaaggatatggagaaa
gaaatcaggaaacaagtagatgacgccattgcaaaagcaaaagaaagttctatgcctgat
acttctgagctcttcacaaatgtttataagaagggattcaacgtggagtcatttgggccc
gacaggaaggagttgagagctactcttccgtag

DBGET integrated database retrieval system