KEGG   Zea mays (maize): 100283889Help
Entry
100283889         CDS       T01088                                 

Definition
pyruvate dehydrogenase E1 component alpha subunit
Orthology
K00161  
pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100283889
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100283889
   00020 Citrate cycle (TCA cycle)
    100283889
   00620 Pyruvate metabolism
    100283889
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     100283889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 390 aa AA seqDB search
MAAAALLRRIPAARAPATAFMAARPVSDSTAALTIETSVPFTSHLVDPPSRDVTTTPAEL
VTFFRDMSLMRRMEIAADSLYKAKLIRGFCHLYDGQEAVAVGMEAAITRSDSIITAYRDH
CTYLARGGDLVSAFSELMGREGGCSRGKGGSMHFYKKDANFYGGHGIVGAQVPLGCGLAF
AQKYKKEETATFALYGDGAANQGQLFEALNISALWKLPAILVCENNHYGMGTAEWRAAKS
PAYYKRGDYVPGLKVDGMDVLAVKQACKFAKDHAVANGPIVLEMDTYRYHGHSMSDPGST
YRTRDEISGVRQERDPIERVRKLLLAHDLATAAELKDMEKEIRKQVDDAIAKAKESSMPD
TSELFTNVYKKGFNVESFGPDRKELRATLP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccgcgctccttcgccgcatccccgccgcgcgggccccggccacggccttc
atggcggcgcgcccggtctccgattccacggcggcgctcaccatcgagacatctgtccct
ttcacctcccacctcgtcgacccgccctcgcgcgatgtcaccaccacccccgccgagctc
gtcaccttcttccgcgacatgtccctcatgcgccgcatggagatcgctgccgactccctc
tataaggccaagctcatccgcgggttctgccacctctacgacggccaggaggccgtcgcc
gtagggatggaggccgccatcacccgctccgattccatcatcaccgcctaccgcgaccac
tgtacctacctcgcccgcggaggggacctcgtctccgccttctccgagctgatgggccgc
gagggcggctgctcccgcgggaagggcggatccatgcatttctataagaaggatgccaat
ttctacggcgggcacggcatcgtcggcgcgcaggtgcccctcggatgcggcctcgccttc
gctcagaagtacaagaaggaggagacggccacgtttgccctctatggtgacggtgcggct
aaccagggacagctctttgaggctctcaacatttcggccctctggaagctgcccgccata
ttggtttgcgagaacaaccattatggtatgggaacagcggaatggagggcagcgaagagt
cctgcttactacaagcgtggcgactatgtgcctggattgaaggttgatggaatggatgtt
cttgctgtgaagcaagcgtgcaaatttgcaaaagatcatgctgttgcaaatggcccaatt
gtccttgagatggatacctacaggtaccatggccactctatgtcagatccaggaagcact
taccgcaccagggatgagatttcaggtgtcaggcaggaacgggacccaattgaaagggtt
agaaagttgcttttggctcacgacttggcaactgctgctgagctcaaggatatggagaaa
gaaatcaggaaacaagtagatgacgccattgcaaaagcaaaagaaagttctatgcctgat
acttctgagctcttcacaaatgtttataagaagggattcaacgtggagtcatttgggccc
gacaggaaggagttgagagctactcttccgtag

DBGET integrated database retrieval system