KEGG   Zea mays (maize): 100283920Help
Entry
100283920         CDS       T01088                                 

Gene name
GRMZM2G042818
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase/ catalytic
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
zma  Zea mays (maize)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100283920 (GRMZM2G042818)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100283920 (GRMZM2G042818)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100283920 (GRMZM2G042818)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100283920 (GRMZM2G042818)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100283920 (GRMZM2G042818)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 384 aa AA seqDB search
MAQQQTNPEEVVLGQEVGAARVATLNRPRQLNGISDRVVYLLAQFLEKWEKDENAKFVIF
KGAGRAFSAGGDLKMFYEGKSNDSCLEVVYRMYWLCYHIHTYKKTMVALVNGLVMGGGAA
MVAPLKFAVVTEKTIFATPEASVGLHTDCSFSYIHSRLPGYLGEYLALTGARLNAKEMIS
AGLATHFVSSEKLEELEKRLLDLDTGAESAVRAVIEEFSTDVQTDEDSILNKLSTINKCF
SAETVEDIIKAFESEASIDGNQWIAPVLKGLRRSSPTALKITLRSIREGRKQSLPECLTK
EFRLTMNILRSVVNGDVYEGIRALSIDKDNAPKWNPTTLEEVKYEDIDRLFQPFSPELEL
QVPSDDSNRWSGKYENTVYGRASQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcagcaaacaaatcctgaagaggtggtcctcgggcaggaggtcggggccgcg
agggtggccactctcaaccgcccgcgccagctcaacggcatctccgacagagtggtgtac
ctcctcgcacagtttctggagaaatgggagaaggatgagaacgccaaattcgtcatcttt
aagggtgctgggcgtgcattttctgctggtggggacctaaagatgttttatgaagggaaa
tcaaatgattcctgcctcgaggttgtgtatagaatgtattggctttgctaccacattcac
acgtacaagaaaaccatggttgctcttgttaatgggcttgtcatgggtggtggcgctgca
atggttgcgccactaaagtttgcagttgtcacagagaaaacaatctttgctactcctgag
gctagtgttggattgcacacagattgtagcttttcctacatccattcccggctccctgga
tatttaggcgagtatctggctttaactggtgctagactgaatgcgaaggaaatgatttct
gctggtcttgctactcattttgtcagttctgaaaaattggaagaacttgaaaaacgtcta
ctggatttggacacaggtgctgagtctgcagtccgagctgttattgaagaattttcaaca
gatgttcaaactgatgaagatagtatattgaataagctttcaactatcaacaaatgcttc
tctgcagagactgttgaggatatcataaaagcatttgaatcagaagcgagcatagacgga
aaccaatggatagctccagtcctaaagggtctgagaagatcatctccaactgcactgaag
atcaccctgagatcgatcagagaaggtcgaaaacagagtttgcctgaatgtttgactaag
gaatttaggcttacaatgaatatactgcggtctgttgtcaatggggatgtttatgagggc
attagagctcttagcatcgataaagacaatgcccctaagtggaatcccactacccttgag
gaggtgaagtacgaggacatcgaccgtctgttccagccgttcagtccggagctggaactt
caggtcccatctgatgattccaacaggtggagcggcaaatacgagaacacggtctatggc
agagcttcccagtga

DBGET integrated database retrieval system