KEGG   Zea mays (maize): 100284052Help
Entry
100284052         CDS       T01088                                 

Gene name
pco065721
Definition
LOC100284052 (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
zma  Zea mays (maize)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100284052 (pco065721)
Enzymes [BR:zma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100284052 (pco065721)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100284052 (pco065721)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 426 aa AA seqDB search
MAFTVSFSPANVQMLQARSGHGHATFGSCSAVPRAGPRLRSTAVRVSSEQEAAAAVRAPS
GRTIEECEADAVAGKFPAPPPLVRPKAPEGTPEIRPLDMAKRPRRNRKSPALRAAFQETS
ISPANFVLPLFIHEGEEDAPIGAMPGCYRLGWRHGLLDEVYKARDVGVNSFVLFPKVPDA
LKSPTGDEAYNDNGLVPRTIRLLKDKFPDIVIYTDVALDPYSSDGHDGIVREDGVIMNDE
TVYQLCKQAVSQARAGADVVSPSDMMDGRIGALRSALDAEGFHDVSIMSYTAKYASSFYG
PFREALDSNPRFGDKKTYHMNPANYREALIETAADEAEGADILLVKPGLPYLDIIRLLRD
HSALPIAAYQVSGEYSMIKAGGALGMVDEQKVMMESLMCLRRAGADVILTYFARHAAAVL
CGMGPK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaccgtctccttctcccccgccaacgttcagatgctccaggctaggagtggc
cacggccacgccacctttggaagctgttccgccgtgccaagagccgggccaaggctgcgc
tccacggccgtccgggtcagcagcgagcaggaggcggcggcggccgtcagggcgccgtcc
gggaggaccatcgaggagtgcgaggccgacgccgtcgctgggaagttccctgctcccccg
ccgctggttaggccgaaggcccctgaaggaacgccggaaatcaggccccttgacatggca
aagcgcccccgtcgcaaccgcaaatcacctgctcttagggctgcattccaggagacgagc
atctcgcctgctaactttgtgcttccattgtttatccatgaaggagaagaagatgctcct
atcggagctatgccagggtgctataggcttgggtggaggcacgggctgcttgacgaggtt
tacaaggcccgcgatgttggtgttaatagttttgttctctttcctaaagttcccgatgca
ttgaagtctccaacaggagatgaagcgtacaacgataatggtctggttccacgtacaatc
cgcttgctcaaggacaagttccctgatattgttatctacacagacgtcgcgttagaccct
tattcatctgatggtcatgatggtattgtgagggaagatggtgtaattatgaatgatgaa
acagtttatcagttgtgcaaacaggctgtttcacaggctcgtgccggtgctgatgttgtc
agccctagtgacatgatggatggccggattggagcacttcgctctgctctggacgccgag
ggcttccatgatgtctccattatgtcctacaccgcaaagtatgccagttcattttatggc
cctttccgagaagctttagattcaaatccaagatttggagataagaagacgtaccatatg
aacccagctaactacagagaagccctcatagaaaccgcagcggacgaggcagaaggagcc
gacattctgctagtgaaaccgggattgccgtacttggacattatccgactgcttcgggat
cattcagccctaccgattgctgcttaccaggtctcgggcgagtactcgatgatcaaagcc
ggcggggccctgggcatggtggacgagcagaaggtgatgatggagtcgctcatgtgcctg
cggcgagccggcgccgacgtcatcctgacctacttcgcccgtcacgccgccgcggtgctg
tgcggcatggggcccaagtag

DBGET integrated database retrieval system