KEGG   Zea mays (maize): 100284181Help
Entry
100284181         CDS       T01088                                 

Gene name
csu1007(eif4F)
Definition
LOC100284181
Orthology
K03259  
translation initiation factor 4E
Organism
zma  Zea mays (maize)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100284181 (csu1007(eif4F))
Translation factors [BR:zma03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100284181 (csu1007(eif4F))
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 210 aa AA seqDB search
MAEVEAPAAAVAAATPEVATVTEGGAATEAKGPHKLHRQWTFWYDIQSKPKPGAAWGTSL
KKAYTFDTVEEFWGLYDHVFRPSKLPGTADFHLFKAGVEPKWEDPECANGGKWTVPCNRK
PTFETMWLETLMALVGDQFDETDDICGIVASVRPRGDKLALWTRTASNEAVQVNIGKKWK
DVIDYNDKIIYTFHDDSRRDKPSRGGRYTV
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtcgaggctccagctgctgcggttgcggcggcgacccctgaggtggcgacg
gtgaccgagggcggagccgctacggaggcgaagggtccgcataagctgcaccgccagtgg
accttctggtacgacatccagtccaagcccaagcccggcgctgcgtggggcacctccctc
aaaaaggcgtacaccttcgacaccgtcgaggagttttggggcttgtatgatcatgttttc
cgtccaagcaagttgcctggaactgctgattttcacctattcaaggctggagtagagcca
aaatgggaagacccagagtgtgcaaatggtggtaaatggactgtcccatgcaacagaaag
ccaacctttgagaccatgtggcttgaaacgttgatggctcttgttggggatcagtttgat
gaaacagatgacatttgtggaattgttgctagtgtccgtccaagaggagataagcttgca
ttgtggactaggactgccagcaatgaagctgtccaggtaaacattggcaagaaatggaag
gatgtcatcgactacaatgacaagatcatctacactttccatgacgactcgagaagggat
aagccaagcagaggtggacggtacaccgtgtaa

DBGET integrated database retrieval system