KEGG   Zea mays (maize): 100284227Help
Entry
100284227         CDS       T01088                                 

Definition
serine/threonine-protein phosphatase PP1 (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
zma  Zea mays (maize)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:zma03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 322 aa AA seqDB search
MMMTRAPMGPMEGAAVDEMVRRLVEGGRGGRQVQLSEAEIRQLCVEGKRVLLSQPNLLRI
HAPVKICGDIHGQFVDLLRLFDLGGYPPASTYVFLGDYVDRGKQSLETICLLLAYKIRYP
ENIFLLRGNHEDAKINRVYGFYDECKRRFNVRLWKIFSDCFNCLPIAALIDDKILCMHGG
LSPELTSLDQIKDIERPAEIPDYGLLCDLLWSDPSPDGEGWGESDRGVSCTFGADKLVEF
LEKNDLDLICRAHQVVEDGYEFFAQRRLVTIFSAPNYCGEFDNVGALLSIDESLMCSFQI
LKPTDMGPPHARKQIPNKPTRG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgacgcgggcaccgatggggccgatggagggcgcggcggtggacgagatggtg
cgccgcctcgtggagggcggccgaggcgggcgccaggtgcagctgtccgaggcggagatc
cggcagctctgcgtagagggcaagcgggtgctcctctcccagcccaatctcctccgaatc
cacgccccagtcaagatctgcggtgatatccatggccagtttgtcgaccttctgagatta
ttcgatttgggtggttatcctccagcttcaacttacgtattcctcggagactatgtcgat
agaggcaaacagagcctggagactatatgcttgctgctggcgtacaaaatccggtacccc
gaaaatattttcctgttgaggggtaaccacgaggatgcaaagatcaacagagtctatggt
ttttatgacgaatgtaagaggaggttcaatgttcggctgtggaagatattctctgattgc
ttcaactgcctgcccatcgcagcgctcatcgatgacaagatactgtgcatgcatggtggc
ctctcgcccgaattgactagtttggaccagataaaagatattgagcgacctgctgagatt
cctgattatggtctcctgtgtgatctgctttggtctgatcctagccccgatggagaaggg
tggggggagagtgacaggggtgtctcgtgtacgtttggtgcagataaacttgtagagttt
ttggagaagaatgatctcgatcttatatgccgagctcatcaggtggttgaagatggctat
gagttctttgcacaacgaagattagtgacaatcttttcagctccaaattattgtggagag
tttgataatgttggcgctcttttaagcatagatgagagcctaatgtgttcatttcagatc
ctgaagccaactgatatgggtccaccgcatgcaagaaaacaaattccaaataagccaaca
agagggtga

DBGET integrated database retrieval system