KEGG   Zea mays (maize): 100284313Help
Entry
100284313         CDS       T01088                                 

Definition
mov34/MPN/PAD-1 family protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:zma00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100284313
Enzymes [BR:zma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100284313
Peptidases [BR:zma01002]
 Metallo Peptidases
  Family M67
   100284313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 517 aa AA seqDB search
MASELSHGTRRDVCIESMARPIAVDHRISIHYYFRIADNLLRQANVYREEKNVLDLYILL
LRYSSLLLETIPKHRDYNAFKAREKEFLKKGPHNSEKILGIVNELESLKPVVQQQIATGN
SRGADEPNGVYGTYAASSELEHHTSGPYVSKSLSGSPTRLLQKPLPGSKHQAAMSQNVQP
YRHAMKPSTNMLYPKEETLSRHSILGPNGLQGNLGQWARPVTGIRIEYPHNPELTQSDIS
SLMPTTLNQDGLRGPSTASQGKSDDMLSVLSLDDGRWSLPLEPASVSPGLEAEFSHLNIR
QPSPPPVLAQVHPEHGQIPPSRVADPRPGLATSATGRYQNLHVPVALMECFLRVAELNTA
KNLETCGILAGTLKKRTFYVTTLIIPKQKSTSDSCQATNEEEIFEVQDKGSLLSLGWIHT
HPTQTCFLSSIDLHNHYAYQIMLPEAIAIVMAPTDTTRKHGIFHLTEPCGMGVIHDCDAT
GFHPHEEPLDGTPIYEHCSHVYMNPNVRFEMTDLREA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggaactatctcacggcactaggagagacgtatgcatcgagtccatggcgcgg
cctatcgccgtggaccaccgcataagcatccactactatttccgcatcgctgacaacctc
ctccgccaggctaatgtgtatcgagaagagaagaatgttctggacctctacatcctcctc
ctgagatactcgagcttgttgcttgagaccatacccaaacatcgcgattataatgcattt
aaggctagagaaaaggaattcctgaagaaaggcccacacaactctgagaaaattcttggt
attgtcaatgagctagagtcccttaagccagttgtgcagcaacaaattgccaccggtaat
agcaggggtgcagatgaacctaatggtgtatatggaacctatgctgcaagtagtgagttg
gagcaccatacctcaggcccatatgtgtcgaagtccttgtctggaagccctactagacta
ctgcagaaaccattacctggttcaaagcatcaagcagctatgtcgcagaatgttcaacct
tatagacatgctatgaaaccatctaccaacatgctgtatccaaaagaggaaacattatcg
agacactcgatactaggacctaatgggcttcaggggaatctgggtcaatgggcaagacct
gttactggtatcaggattgagtatccacataatcctgaattaacccaaagtgacatttct
agtttaatgccaacaaccttgaaccaagatggtttgcgtggtcccagtacagcatctcag
ggcaaaagtgacgatatgctgtctgttctatcgcttgatgatggcaggtggtcattacca
ttagaaccagcctcagtgtctcctggtttggaagcagagttctctcacctgaatattaga
caaccttctcccccacctgtcctagctcaagtgcaccctgagcatggtcaaattcctcca
tcaagagttgctgatccaagaccaggacttgctacatctgcaaccggacgctatcagaat
ttgcatgtgccagtggcattaatggagtgtttcctgagggtcgctgagttaaataccgca
aagaatttggaaacctgtggaattcttgctggtactctgaaaaagagaaccttttatgtg
acaacattgataattcctaagcagaaatcaacatctgattcatgtcaagctacgaatgaa
gaagaaatatttgaagttcaggacaaaggctcccttttatctcttggttggattcacaca
catccaacacagacctgcttcctatcttccattgatcttcataatcattacgcatatcag
attatgcttccggaagcgattgcaatagttatggctcctacggatacaacaagaaaacat
ggcatatttcatctaacggagccatgtggcatgggcgtgatccatgattgtgatgcaact
ggattccaccctcatgaggagcccctagatggaacaccaatctatgagcattgctcccat
gtgtacatgaacccaaatgtcaggtttgagatgacagacctacgtgaagcatga

DBGET integrated database retrieval system