KEGG   Zea mays (maize): 100284667Help
Entry
100284667         CDS       T01088                                 

Definition
1-O-acylceramide synthase
Organism
zma  Zea mays (maize)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 426 aa AA seqDB search
MVLAPALLVVAALLAQPLGSRSGDDAGAANLHPVVLLPGYGSNQLEAMLTAAYEPPAPAC
AGSADQGWFPLWPNHTAMRDASQVPCFADQMSLVYDAGADDYRNADGVATRTPFFGSARA
LIGWDRLVQQLEGMGYRDGETLHAAPYDFRYAVAPPGHPSAVGDRYFRDLGRLIQASRLN
HGRPAIVVAHSFGCALTYQLLLSRPLPWRRRYVKHVVLLGPALGGFAQGMRLLSAGMDYG
LPNVPRPAMLRMARTQQSALWRLPTPLVFGDRPLAVTSAAAYSARNVSAFLEAIGFQEGV
RPYLTRVLPMWEALPPPMVPVTSVVGFGVSTPETYVFGADGLEGEAEVLYGDGDGEINMV
SLAAVERWSEVEGQVLKVVRLRGVHHDGFFSIDFALNSTLAEISEAGESVIEQIGIVSCQ
QKRSDY
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggttctcgctcctgcgctcctcgtcgtggcggcgctcctggcccagccgctcgggagc
cgttccggcgacgacgccggggccgcgaacctgcacccggtcgtgctcttgccgggctac
ggttccaaccagctggaggcgatgctgacggcggcgtacgagcccccggcgcctgcctgt
gccggctccgcggaccagggttggttccctctctggccaaaccacacggcgatgcgcgac
gctagccaggtcccctgcttcgccgaccagatgagcctcgtctacgacgccggcgccgac
gactaccgcaacgccgacggcgtcgctacccggaccccgttcttcggctcggcgcgcgcc
ctcatcgggtgggacaggctggtgcagcagctggaaggcatgggctaccgcgacggcgag
accctccacgcggcgccgtacgacttccgctacgccgtggcgcctcccggccacccgtcc
gcggtgggggaccgctacttccgcgacctcgggcgcctcatccaggcgagccgcctcaac
catggccgcccggccatcgtggtcgcgcacagcttcggctgcgcgctcacctaccagctc
ctcctgtcccgcccgctcccctggcgccgccgctacgtgaagcacgtcgtcctcctgggc
cccgcgctcggcgggttcgcgcaggggatgcgcctcctcagcgccggcatggactacggc
ctcccgaacgtcccgcggccggcgatgctccggatggcgcggacccagcagagcgccctg
tggcgcctgcccacgccgctcgtcttcggggaccggccgctggcggtgaccagcgccgcg
gcctactcggcgcgcaacgtgtcggcgttcctcgaggccatcggtttccaggaaggcgtg
cggccgtacctgacgcgggtgctgccgatgtgggaggcgctgccgccgccgatggtgccg
gtcaccagcgtcgtcgggttcggcgtcagcacgcccgagacgtacgtgttcggggccgac
gggctcgagggggaggccgaggtgctgtacggcgacggcgacggggagatcaacatggtg
agcctggcggctgtcgagagatggtcggaggtggaaggccaggtcttgaaggtcgttagg
ctgcgcggcgtccatcacgacggtttcttcagcatcgatttcgcgttgaatagcacactt
gctgagatatcggaggcaggagaaagcgtcattgaacagatcggcattgtatcgtgtcag
cagaaacgcagtgattactga

DBGET integrated database retrieval system