KEGG   Zea mays (maize): 100284667Help
Entry
100284667         CDS       T01088                                 

Definition
1-O-acylceramide synthase
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
zma  Zea mays (maize)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100284667
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100284667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 426 aa AA seqDB search
MVLAPALLVVAALLAQPLGSRSGDDAGAANLHPVVLLPGYGSNQLEAMLTAAYEPPAPAC
AGSADQGWFPLWPNHTAMRDASQVPCFADQMSLVYDAGADDYRNADGVATRTPFFGSARA
LIGWDRLVQQLEGMGYRDGETLHAAPYDFRYAVAPPGHPSAVGDRYFRDLGRLIQASRLN
HGRPAIVVAHSFGCALTYQLLLSRPLPWRRRYVKHVVLLGPALGGFAQGMRLLSAGMDYG
LPNVPRPAMLRMARTQQSALWRLPTPLVFGDRPLAVTSAAAYSARNVSAFLEAIGFQEGV
RPYLTRVLPMWEALPPPMVPVTSVVGFGVSTPETYVFGADGLEGEAEVLYGDGDGEINMV
SLAAVERWSEVEGQVLKVVRLRGVHHDGFFSIDFALNSTLAEISEAGESVIEQIGIVSCQ
QKRSDY
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggttctcgctcctgcgctcctcgtcgtggcggcgctcctggcccagccgctcgggagc
cgttccggcgacgacgccggggccgcgaacctgcacccggtcgtgctcttgccgggctac
ggttccaaccagctggaggcgatgctgacggcggcgtacgagcccccggcgcctgcctgt
gccggctccgcggaccagggttggttccctctctggccaaaccacacggcgatgcgcgac
gctagccaggtcccctgcttcgccgaccagatgagcctcgtctacgacgccggcgccgac
gactaccgcaacgccgacggcgtcgctacccggaccccgttcttcggctcggcgcgcgcc
ctcatcgggtgggacaggctggtgcagcagctggaaggcatgggctaccgcgacggcgag
accctccacgcggcgccgtacgacttccgctacgccgtggcgcctcccggccacccgtcc
gcggtgggggaccgctacttccgcgacctcgggcgcctcatccaggcgagccgcctcaac
catggccgcccggccatcgtggtcgcgcacagcttcggctgcgcgctcacctaccagctc
ctcctgtcccgcccgctcccctggcgccgccgctacgtgaagcacgtcgtcctcctgggc
cccgcgctcggcgggttcgcgcaggggatgcgcctcctcagcgccggcatggactacggc
ctcccgaacgtcccgcggccggcgatgctccggatggcgcggacccagcagagcgccctg
tggcgcctgcccacgccgctcgtcttcggggaccggccgctggcggtgaccagcgccgcg
gcctactcggcgcgcaacgtgtcggcgttcctcgaggccatcggtttccaggaaggcgtg
cggccgtacctgacgcgggtgctgccgatgtgggaggcgctgccgccgccgatggtgccg
gtcaccagcgtcgtcgggttcggcgtcagcacgcccgagacgtacgtgttcggggccgac
gggctcgagggggaggccgaggtgctgtacggcgacggcgacggggagatcaacatggtg
agcctggcggctgtcgagagatggtcggaggtggaaggccaggtcttgaaggtcgttagg
ctgcgcggcgtccatcacgacggtttcttcagcatcgatttcgcgttgaatagcacactt
gctgagatatcggaggcaggagaaagcgtcattgaacagatcggcattgtatcgtgtcag
cagaaacgcagtgattactga

DBGET integrated database retrieval system