KEGG   Zea mays (maize): 100284895Help
Entry
100284895         CDS       T01088                                 

Definition
D-erythro-sphingosine kinase/ diacylglycerol kinase
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
zma  Zea mays (maize)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100284895
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100284895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 504 aa AA seqDB search
MADHQPQVEVLTESVRVNGTKAEATLVGGELAWRPAAGGNGEGQERRLELESEVLGFQMD
GRQLKFATFAASGGGNGKGGGGDGNRRRGEVEMEMENEATAVRWGDVISDRLASLGRPKK
LFIIVNPYGGKRSGPSIFQNEVLPLIEASGVLYTMQETKHRLHAQEIAHSLDLRKYDGII
CVSGDGVMVEVVNGLLQREDWEAAIKVPLGIIPAGTGNGMARSLLHAAGEPFSISNAVFA
IIRGHKRALDVTSVVQGKARFFSVLMLTWGLVADVDIESEKYRWMGSARLDFYLLLRILN
LRRYNGRILFVPAPGYEEVGDPVDQATGYETNGFSTGFQDDGRTGSNGETCGYVGPSSIK
EAGLRWRSLDGPFVSVWLGNVPFASEDAMAAPKAEFADGYLDAAIIKDCPRWDVLGLVFQ
MKDGSYVNSPCVEYFKVKAIRIEPGLRVGSSTEGGIIDSDGEVIARGDESDSRAGDDEPG
HLMAYGPPIQLTVDQGLATIFSPR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcaccagcctcaggtcgaggtcctgaccgagtcagtgcgggtcaacggcacc
aaggcggaggccacgctcgtgggaggcgagctggcgtggcgccccgccgccggcggcaac
ggagaggggcaggagcggcggctggagctggagtcggaggtgctcgggttccagatggac
gggaggcagctcaaattcgcgacctttgccgcgagcggcggcggtaatgggaaaggggga
ggaggggatgggaatcggaggagaggggaggtggagatggagatggagaacgaggccacc
gcggtgcggtggggggacgtaatcagtgatcgcctagcctcgctcggccggccaaagaaa
ttgttcattatagtgaacccttatggtggaaagagaagcggaccgagtattttccagaat
gaagtcctccccctcattgaagcttctggcgtgctttatacgatgcaagaaaccaagcat
cgccttcatgctcaagagattgcacattcacttgatcttaggaagtatgacggcatcatt
tgtgtcagtggagatggtgtgatggtagaggttgtcaatggtctcctgcaaagggaggac
tgggaagcagcaataaaagtgccccttgggatcattccagcaggtactggaaatggaatg
gcacgatctctactgcatgctgctggtgaaccattctctatatctaatgctgtgttcgca
atcatcagaggtcataaacgtgcccttgatgttacttctgttgtgcagggaaaggcgagg
ttctttagtgtcctgatgcttacatggggtctggtggctgatgttgatattgaatcagag
aagtataggtggatgggaagtgctcgccttgatttttatcttctactccgcattctgaac
ctgcgacggtacaatgggcgtatcctttttgttccagcaccaggatacgaagaagttggt
gatcctgtggaccaagctaccggttacgaaacaaacgggtttagcacgggatttcaagac
gacggaagaaccggcagtaatggtgagacgtgtggctatgtgggcccatcgtcgatcaaa
gaagctggtcttagatggagatcactggatgggccattcgtttcagtctggctcggcaat
gttcctttcgctagcgaagatgccatggcagcaccaaaagctgagtttgcggatggctac
ttggatgctgctataatcaaggattgtcctcggtgggatgtcctcgggctcgtgttccag
atgaaggacggcagctacgtgaactcgccatgcgtggagtacttcaaggtgaaggcgatc
cggatcgagccgggcctgcgcgtgggcagcagcaccgagggcggtatcatcgactcggac
ggggaggtgatcgcgaggggcgacgagtccgattcccgcgccggcgacgacgagccgggg
cacctgatggcgtacggcccgcccatccagctgacggtggaccaggggctggccaccatc
ttctccccgagatga

DBGET integrated database retrieval system