KEGG   Zea mays (maize): 100284953Help
Entry
100284953         CDS       T01088                                 

Gene name
pco060326
Definition
LOC100284953
Orthology
K18674  
N-acetylgalactosamine kinase [EC:2.7.1.157]
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100284953 (pco060326)
   00520 Amino sugar and nucleotide sugar metabolism
    100284953 (pco060326)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     100284953 (pco060326)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100284953 (pco060326)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 508 aa AA seqDB search
MAALPASAPAPAPAPSEAAELVPTLSSLEPVYGAGAQLDDARIRFARLGDRFHAVYGARP
ALFARSPGRVNLIGEHIDYEGYSVLPMAIRQDMIVAIRRANGDQVRVANVDDKYPLCVYP
ADPDKEIDVKNHKWGHYFMCGYKGVYEYCRSKGIDLGKPVALDVVVDGTVPQGSGLSSSA
AFVCSATIAIMGILDKNFPKKEVAQFTCLSERHIGTQSGGMDQAISIMAKPGFAELIDFN
PIHATDVQLPSGGTFVIAHCLAESKKAETAATNYNNRVVECRLAAIVLAIKLGMDRKKAI
SSVTTLSDVEGLCVSFAGREGSSDPAVAVKKLLHEDPYTGGEIEKITGEGLTSVFQGSQT
SLDVIKAAKHYKLFQRATHVYSEARRVYAFRDTVSSKLSEEGKLKKLGDLMNESHYSCSV
LYECSCPELEELVKVCRDNGALGARLTGAGWGGCAVALVKEPIVPQFILKLKEMYYKSRI
DRGVIKQGDVGLYVFASKPSSGAAILRL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgttacccgccagcgcccccgcccccgcccccgccccctccgaggcggcggag
ctcgtgccgacgctctcctcgctggagccggtctacggcgcgggcgcgcagctcgacgac
gcgcgcatccgctttgcccgcctcggggaccgcttccacgccgtctacggcgcccgcccc
gcgctcttcgcccgctccccagggagggtcaatctgatcggggagcacatcgactacgag
ggctactcggtgttgccgatggccatccgccaggacatgatcgtcgccatccgaagggcc
aacggcgaccaggtgagggtcgccaacgtcgacgacaagtaccccctctgcgtttacccc
gccgacccagacaaggaaattgacgtaaaaaatcacaaatgggggcactatttcatgtgt
ggatacaagggagtttatgaatactgtagatcaaaagggatagatctgggcaaacctgtt
gcgcttgacgtcgttgttgatggcacagttcctcaaggctctggactgtcaagctcagca
gcgtttgtctgttcagcaacaattgctatcatgggaatccttgacaaaaattttccaaag
aaagaagttgctcaattcacttgtctgtctgagcgccacattggaacgcaatctggcggc
atggatcaggctatatctatcatggcgaaacctggattcgctgagttgatagattttaat
ccaatccatgcaactgacgtccaactaccttcaggtggtacatttgtgatcgcccattgt
ttggccgagtccaagaaagcagagacagctgcaacaaattataataaccgcgttgtggag
tgtcgcttagcagcgattgttcttgccatcaaacttgggatggataggaaaaaagctatc
tcctccgttacaaccctctccgatgttgaggggctatgtgtttcttttgctgggagagaa
ggttcatctgatcctgcagtagctgtgaagaaacttctgcatgaggacccatatacaggt
ggagaaatagagaaaattacaggagaaggcctgacatctgtcttccagggctctcagacg
tcattggatgttataaaagcggcaaagcactacaagctatttcagcgtgcgacccatgtc
tactctgaagcaaggagggtttatgctttcagggatactgtctcttcaaaactcagtgag
gaaggcaagcttaagaaacttggtgatcttatgaacgagagccattacagctgcagcgtg
ctatacgaatgcagttgccctgagctggaggagcttgtgaaggtctgcagagacaacgga
gcactgggagcacgtctgacaggagctgggtggggtggctgcgcggttgctctggtcaag
gagcccatcgtcccccagttcattctgaaactaaaggaaatgtactacaaatcaaggatt
gacaggggagtaatcaagcagggcgatgtgggcctgtacgtgttcgcatccaagccgtcg
agcggcgcggccatactgaggttgtag

DBGET integrated database retrieval system