KEGG   Zea mays (maize): 100284953Help
Entry
100284953         CDS       T01088                                 

Gene name
pco060326
Definition
(RefSeq) uncharacterized protein LOC100284953
  KO
K18674  N-acetylgalactosamine kinase [EC:2.7.1.157]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.157  N-acetylgalactosamine kinase
     100284953 (pco060326)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 100284953
NCBI-ProteinID: NP_001151320
UniProt: C0HGF4 B6TZ40
Position
1
AA seq 504 aa AA seqDB search
MAAVPASAPAAAEAAELVPTLSSLEPVYGAGAQLDESRLRFARLGDRFHAVYGARPALFA
RSPGRVNLIGEHIDYEGYSVLPMAIRQDMIVAIRRANGAQVRVANVDDKYPLCVYPADPD
KEIDVKNHKWGHYFMCGYKGVYEYCRSKGIDLGKPVALDVVVDGTVPQGSGLSSSAAFVC
SATIAIMGILDKNFPKKEVAQFTCLSERHIGTQSGGMDQAISIMAKPGFAELIDFNPIHA
TDVQLPSGGTFVIAHCLAESKKAETAATNYNNRVVECRLAAIVLAIKLGMDRKKAISSVT
TLSDVEGLCVSFAGREGSSDPAVAVKKLLHEDPYTAGEIEKITGEGLTSVFQGSQTSLDV
IKAAKHYKLFQRATHVYSEARRVYAFRDTVSSKLSEEGKLKKLGDLMNESHYSCSVLYEC
SCPELEELVKVCRDNGALGARLTGAGWGGCAVALVKEPIVPQFILKLKEMYYKSRIDRGV
IKQGDVGLYVFASKPSSGAAILRL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggtacccgccagcgcccccgccgccgccgaggcggcggagctcgtgccgacg
ctctcctcgctggagccggtctacggcgcgggcgcgcagctcgacgagtcgcgcctccgc
ttcgcccgcctcggggaccgcttccacgccgtctacggcgcccgccccgcgctcttcgcc
cgctccccagggagggtcaatctgatcggggagcacatcgactacgagggctactcggtg
ttgccgatggccatccgccaggacatgatcgtcgccatccgaagggccaacggcgcccag
gtgagggtcgccaacgtcgacgacaagtaccccctctgcgtttaccccgccgacccagac
aaggaaattgacgtaaaaaatcacaaatgggggcactatttcatgtgtggatacaaggga
gtttatgaatactgtagatcaaaagggatagatctgggcaaacctgttgcgcttgacgtc
gttgttgatggcacagttcctcaaggctctggactgtcaagctcagcagcatttgtctgt
tcagcaacaattgctatcatgggaatccttgacaaaaactttccaaagaaagaagttgct
caattcacttgtctgtctgagcgccacattggaacgcaatctggcggcatggatcaggct
atatctatcatggcgaaacctggattcgctgagttgatagattttaatccaatccatgca
actgacgtccaactaccttcaggtggtacatttgtgatcgcccattgtttggccgagtcc
aagaaagcagagacagctgcaacaaattataataaccgtgttgtggagtgtcgcttagca
gcgattgttcttgccatcaaacttgggatggataggaaaaaggctatctcctccgttaca
accctctccgatgttgaggggctatgtgtttcttttgctgggagagaaggttcatctgat
cctgcagtagctgtgaagaaacttctgcatgaggacccatatacagctggagaaatagag
aaaattacaggagaaggcctgacatctgtcttccagggctctcagacgtcattggatgtt
ataaaagcggcaaagcactacaagctatttcagcgtgcgacccatgtctactctgaagca
aggagggtttatgctttcagggatactgtctcttcaaaactcagtgaggaaggcaagctt
aagaaacttggtgatcttatgaacgagagccattacagctgcagcgtgctatacgaatgc
agttgccctgagctggaggagcttgtgaaggtctgcagagacaacggagcactgggagca
cgtctgacaggagctgggtggggtggctgcgcggttgctctggtcaaggagcccatcgtc
cctcagttcattctgaaactaaaggaaatgtactacaaatcaaggattgacaggggagta
atcaagcagggcgatgtgggcctatacgtgttcgcatccaagccgtcgagcggcgcggcc
atactgaggttgtag

DBGET integrated database retrieval system