KEGG   Zea mays (maize): 100285013Help
Entry
100285013         CDS       T01088                                 

Definition
OB-fold nucleic acid binding domain containing protein
Orthology
K10739  
replication factor A2
Organism
zma  Zea mays (maize)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100285013
   03420 Nucleotide excision repair
    100285013
   03430 Mismatch repair
    100285013
   03440 Homologous recombination
    100285013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 337 aa AA seqDB search
MASYFAGPAIVPSQHATAAPDNSAVATPSPVKSRDPRFSGSASTTVRHIARSFAAAEATG
DGDLVIPIDGVDATNVWILGRVVSVVNMEASVSFTLDDGTGKIALTRWIAEDIDAKEVAF
VQNGIYLKVQVTLVGFQTKQYGFARAIRPVTNFNEVALHFIDCIYLHLENVRQKMQGQFP
RSIQANVSTYEMQAQVAHSVQTKSPAHIPFSGGARDHQVDFAPEVNHGRFPSSVQTNTPT
HVPFSGGAREQQVHFTPQPNQFSAYPGTGGHQHDLQSMVLEVMQRPDILALENGVHVDEV
ARRLGMPSAQIMVTARRLVNLACLCSTIDDYHFKSIK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctacttcgccggtccggccatcgtgccgtcgcagcacgccaccgcggcgccc
gacaattccgcggtcgccaccccttctccggttaagtcgcgtgacccccgcttctccgga
tccgcctccaccaccgttcgtcacatcgcccgctccttcgccgccgccgaagccaccggt
gatggcgaccttgtcatccctatcgacggcgtcgacgccaccaacgtttggattctgggg
agggtggtgagcgtggtgaacatggaggccagcgtgtcgttcacgctcgacgacggcacc
gggaagatcgcgctcacgcggtggatcgctgaagatattgatgctaaggaagtggctttc
gtccagaatggtatatacctcaaggttcaagttactctcgtagggtttcaaactaagcag
tatggttttgctcgcgctattcggcctgttaccaatttcaatgaagtggcgctgcacttc
attgattgtatttatttgcatttggaaaatgtacggcaaaagatgcaaggtcaattccct
cgctccattcaagcaaatgtgtctacttatgagatgcaagctcaagttgctcacagtgtt
caaacaaaatcacctgctcatatccccttttctggtggagctagagatcatcaagttgat
tttgctcctgaagtaaaccatgggcgattcccttcatcagttcaaacaaacacacctact
catgtacccttttctggtggagctagggaacagcaagttcactttactcctcaaccaaat
caattttcagcttacccaggtacaggtggtcatcagcacgatctgcagagtatggttttg
gaggttatgcaacgaccagatatacttgcacttgaaaatggagtacatgttgatgaagtg
gcaaggagacttggaatgccaagcgcacaaattatggtcaccgcccggcgtcttgtcaat
ttggcatgcctctgttccactattgatgattatcatttcaagtctattaaatga

DBGET integrated database retrieval system