KEGG   Zea mays (maize): 100285169Help
Entry
100285169         CDS       T01088                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 2 precursor
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
zma  Zea mays (maize)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100285169
   00500 Starch and sucrose metabolism
    100285169
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100285169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
10
AA seq 595 aa AA seqDB search
MRALGTVAWAWLLLLQQLAGASHVVYENLEVEATTAAVRPSIVDPLLRTGYHFQPRKNWI
NDPNAPLYYKGWYHLFYQYNPKGAVWGNIVWGHSVSRDLINWVALQPAIEPSIPSDRYGC
WSGSATTLADGTPAIMYTGVNRPDVNYQVQNVAYPRNRSDPLLREWVKPSHNPIIVPGGG
INATQFRDPTTAWRGAGDGRWRLLIGSVTEARHGVAYVYRSRDFRRWTRARRPLHSAATG
MWECPDFYPVGAPGRRAGVETETSAASDGDGGSPRRREQSKYVLKNSLDLRRYDYYTVGT
YDRAAERYVPDDPAGDERHLRYDYGNFYASKTFFDPVKRRRVLWGWANESDTAADDVAKG
WAGIQAIPRTVWLDPSGKQLLQWPIEEVEALRGRSVALKNRVIKPGQXVXVTGIQTAQAD
VEVSFEVSSLAGAEALLDPALASDAQRLCGARGAAVEGGVGPFGLWVLASGDREERTAVF
FRVFRGGGGHDDKPVVLMCTDPTKSSLDANLYQPTFAGFVDTDISNGKISLRTLIDRSVV
ESFGGGGRTCILSRVYPSLAIGSKARLYVFNNGRADVRVSRLTAWEMKKPLMNGA
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgcttggaacggttgcttgggcatggctgctgctcctgcagcagctcgccggg
gcctctcatgtcgtctacgagaaccttgaggtggaggcgacgacagccgccgtgcggccc
tccattgtcgaccccctgctgaggaccgggtaccatttccagcctcgcaagaactggatc
aatgatcccaacgctccactgtactacaaggggtggtaccatctcttctaccaatacaac
ccgaagggcgcggtgtggggcaacatcgtgtggggccactcggtgtcgcgagacctgatc
aactgggtggccctgcaaccggcgatcgagccgagcatcccgtccgacaggtacgggtgc
tggtctgggtcggcgacgacgctggccgacggcacgccggcgatcatgtacacgggcgtg
aaccggccggacgtgaactaccaggtgcagaacgtggcgtacccgcggaacaggtcggac
ccgctgctgcgggagtgggtgaagccgtcgcacaaccccatcatcgtgcccgggggcggc
atcaacgcgacgcagttccgggacccgaccacggcctggcgcggcgcgggagacggccgc
tggcgcctgctcatcggcagcgtcaccgaggcgcgccacggcgtggcgtacgtgtaccgg
agccgcgacttcaggcgctggacgcgggcgcggcggccgctccactcggcggccacgggg
atgtgggagtgccccgacttctacccggtcggcgcgcccggccggcgcgcgggcgtcgag
acggagacgtcggcggcgtccgacggcgacggcggctctcctcgtcgtcgtgagcagtcc
aagtacgtgctgaagaacagcctcgacctgcggcggtacgactactacaccgtcggcacg
tacgaccgggcggccgagcggtacgtgccggacgaccccgcgggagacgagcgccacctg
cggtacgactacggcaacttctacgcgtccaagacgttcttcgaccccgtgaagcggcgg
cgggtgctctggggctgggccaacgagtccgacaccgccgccgacgacgtggccaaaggg
tgggctgggatccaggcgattcctaggacggtgtggctagaccccagcgggaagcagctg
ctgcagtggccaatcgaggaggtggaggctctgagaggcaggtcggtcgctctcaagaac
agggtgatcaagccaggacagcamgtykaggtcacmgggatacaaacggcacaggccgac
gtggaggtgagcttcgaggtgtcgagcctggcgggcgccgaggcgctgctggacccggcg
ctggccagcgacgcgcagcggctgtgcggcgccaggggcgcggccgtggagggcggcgtg
ggcccgttcgggctgtgggtgctcgcctccggcgaccgcgaggagaggaccgccgtgttc
ttcagggtgtttcgcggcggcggcggccacgacgacaagcccgtggtgctcatgtgcacc
gaccccaccaagtcatctctggacgcgaacctgtaccagccgacgttcgcaggttttgtc
gacacagacatttcgaacgggaagatatctctcagaactctgatcgaccggtcggtggtg
gagagctttggaggcgggggcaggacctgcatcctgtcgagggtgtacccgtcgctcgcc
atcggcagcaaggctcgcctctacgtgttcaacaacgggagggcggacgtcagggtgtcc
cgtctcaccgcgtgggagatgaagaagccactcatgaacggcgcttga

DBGET integrated database retrieval system