KEGG   Zea mays (maize): 100285340Help
Entry
100285340         CDS       T01088                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 4
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
zma  Zea mays (maize)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    100285340
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     100285340
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     100285340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 182 aa AA seqDB search
MAPQAWVVAENGEDLQQPREFLPLSKLEDVGVLYWHLDPKKSESEEELAKIRRDRGYSYM
DLIEICPDKLENYEEKVKNFFCEHMHADEEIRYCLEGSGYFDVRDKDDKWIRIRIREGDM
IILPAGIYHRFTLDSAKYTKLMRLFIGEPVWTALNRPQEDHPARQEYVKNVSAGTGFALA
AH
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcaggcgtgggtcgtggcggagaacggcgaggacctccaacaacccagggaa
ttcctgccgctctctaagcttgaagatgttggcgtgttgtattggcatttggaccctaag
aagtctgaaagcgaggaggaactagcaaaaatccgcagagacagaggctacagttacatg
gatcttattgagatatgtcccgacaaactggaaaactatgaggagaaggtgaagaacttc
ttctgtgagcacatgcacgctgacgaagagatccgctattgcttggagggcagcgggtac
tttgacgtccgcgacaaagatgacaagtggattcgaattcggataagagaaggagacatg
atcatcctaccagctggaatttatcatcggttcaccctcgacagcgctaaatacacgaag
ctcatgaggcttttcattggggaaccagtctggaccgcgttaaaccgccctcaggaggac
cacccggcgaggcaagagtatgtcaagaatgtgagtgcgggcactggatttgctcttgca
gcacactga

DBGET integrated database retrieval system