KEGG   Zea mays (maize): 100285405Help
Entry
100285405         CDS       T01088                                 

Definition
endo-1,4-beta-glucanase Cel1
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
zma  Zea mays (maize)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100285405
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     100285405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 621 aa AA seqDB search
MFGRDPWGGPLEISNADSATDDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKKKRY
VDLGCLVVDRKVFMWTVGTVLGLGVFIGFVIMIVKLVPHKRPPPPPPDQYTQALHKALMF
FNAQRSGPLPKHNGVSWRGNSCMKDGLSDSTVRRSLVGGFYDAGDAIKFNYPMAWSMTML
SWSVIEYRAKYEAIGELDHIRELIKWGTDYILKTFNSSADTIDRIVAQVGVGDTSKGSSQ
PNDHYCWMRPEDIDYKRPVTECHSCSDLASEMAAALAAASIVFKDSKTYSDKLVKGAKAL
YKFGRLQRGRYSPNGSDQAIFYNSTSYWDEFVWGGAWMYFATGNNSYLTVATAPGMAKHA
GAYWFGSPNYGVFTWDDKLPGAQVLLSRLRLFLSPGYPYEEILRTFHNQTDNVMCSYLPV
FNSFNFTKGGLIQLNHGRPQPLQYAVNAAFLASLYSDYLEAADTPGWYCGPNFYTIEVLR
KFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKA
NPNILVGAMVAGPDRRDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDKNT
IFSAIPPMFPTPPPPPSAWKP
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgttcgggcgggatccctggggcgggccgctggagatctccaacgccgactcggcgacg
gacgacgaccgcagccgcgacctggaccgggcggcgctgatgcggcagctggacgagacg
cagcagagctggctcctggccgggcccggcgaccaggccggcaagaagaagaagcggtac
gtcgacctcggctgcctcgtcgtcgaccgcaaggtcttcatgtggaccgtcggcaccgtc
ctcggcctcggcgtcttcatcggcttcgtcatcatgatcgtcaagctcgtcccgcacaag
cgccccccgccgccgccgcccgaccagtacacgcaggcgctgcacaaggcgctcatgttc
ttcaacgcgcagcgatccggcccgctgccgaagcacaatggcgtgagctggaggggcaac
tcctgcatgaaggacggcctctccgacagcaccgtccgccggagcctggtcggaggcttc
tacgacgcgggggacgccatcaagttcaactaccccatggcatggtccatgaccatgctc
agctggagcgtcatcgagtacagggccaagtacgaggccatcggcgagctcgaccatatc
agggagctcatcaagtggggaacggactacatcctcaagaccttcaattcgtctgccgac
acgatagacaggatcgtcgctcaggtgggtgtaggtgacacctctaaaggcagcagtcag
cctaacgaccattactgctggatgaggccagaggacatcgactacaagaggccggtcacc
gagtgccactcctgctcagatctagcgtcggaaatggctgccgccctggccgcagcttcc
atagtgttcaaggacagcaagacctactccgacaagctcgtcaagggcgccaaggccctg
tacaagttcggcaggctgcagcgtgggcgatacagccccaacggatctgaccaggccatc
ttctacaactccaccagctactgggacgagttcgtgtggggcggtgcgtggatgtacttc
gccacggggaacaactcgtacctcaccgtcgccacagccccgggaatggcgaagcacgct
ggagcatactggtttggaagtccaaactacggagtgtttacctgggatgacaaacttcca
ggagctcaggttcttctcagcaggctgcgactcttcctaagtccagggtacccttacgaa
gaaatactgaggacattccacaaccaaaccgacaacgtcatgtgctcgtatttacctgta
ttcaattcattcaacttcaccaaaggaggattaatacagctcaaccatggaaggcctcaa
ccgcttcagtacgctgtcaacgcagctttccttgcttctttatacagcgactatcttgaa
gcggctgacacgcctgggtggtactgtggaccgaacttctacaccatagaagtcctccgc
aagtttgccaggtcacagcttgactacatccttggaaagaacccattgaagatgagctac
gttgtgggtttcggaaacaagtacccgaagcgccctcaccacagaggtgcgtcgatacct
cataacggcgtcaagtatggatgcaaaggaggttacaaatggagggacacgaagaaggca
aaccctaacatccttgttggagcaatggtggctggccctgacaggcgtgacggctacaaa
gatgtccgcacgaactacaactacacagagcctacccttgcggcaaacgctggtctggtt
gcagcactgatttctatatctgatatcaaaaccggacggttcggcatcgacaagaacacc
atcttctctgcgatccctccgatgtttccgacaccaccgccgccgccatcagcatggaaa
ccatag

DBGET integrated database retrieval system