KEGG   Zea mays (maize): 100285430Help
Entry
100285430         CDS       T01088                                 

Definition
cysteine-type peptidase
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100285430
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   100285430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 536 aa AA seqDB search
MTRIFVQRGTAGSSSSSGRSGSQSAQQPAAAAREELPLQPQPQLPELLAIDDIAEHLNEG
NENNSSRIKFLRTDDTISESSSYAEERAAREKPPNDDSNVINPTSLVEEPIVLHTPDQIE
HGNSVPSGTNSSQMVGAASHPPPPPAPPPKPLLGNSGLWRMGPGSSNSVRIGSPRRPVAW
PPVAARTSASGSRPSSPRSLIDGEGYNSADEQGPCYASSYDDSERERMFEHDLRRVKGLE
IRKTAEDGNCLFRAVADQVYGDAEAYDMARQMCVDYMERERDHFSQFITESFTLYCKRKR
RDKVYGNNVEIQAFAEMYNRPIHIYSYSTEPINIFQGSYNTDTPPIRLSYHHGNHYNSVV
DPRRQTIGAGLGFSSFRGTNVDRDQVKAAIKAQQDQQIDNALMAEGRFYSDLELTEREIE
RMVMEASRSEYLAKEKKLNIRESSTSGAEPSSSAAISGSSRSVAGADRSSEDYFVLPDTV
LTRSMQLLLAMGFGYNQVMEAYSIFGEDVDSMVCYLVETGGASAGGSNRRKGKAAE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggatcttcgtgcagcgcgggaccgccggctcctcgtccagctccggccgctcg
ggctcgcagtcagcgcagcagccggcagcagctgcccgggaggagttgccgttgcaacct
cagccacagctaccagaactattggctatagatgatatagctgagcatttaaatgagggc
aacgagaacaacagtagcagaattaagtttttgaggacagatgacaccatttcagagagc
tcgagctacgcagaggagagggctgccagggagaagcctcctaacgatgactctaatgta
atcaaccccacttccttggtagaggaaccgatagtgctccatacccctgatcagattgaa
catggaaattctgtgccgtcaggaactaattcatcacagatggtgggtgcagcatcgcac
ccgccgccaccgccagctccgcctccaaaaccattgttggggaatagtgggttgtggaga
atgggacctggaagttccaacagtgtgcggattggatctccaagaagaccggtagcttgg
ccaccagtggcagctcggacatctgcttcaggttctcgtccttcttcgcctaggtcactc
attgatggtgaaggttacaatagtgctgatgaacagggtccctgttacgcctcgagttat
gatgattcggaaagagagcgtatgtttgagcatgacctaaggcgagtgaaagggttggaa
atcagaaagacggccgaagatgggaactgtctattcagagctgttgctgatcaagtttat
ggagatgcagaagcttatgacatggctaggcagatgtgtgttgattatatggaaagggaa
cgggatcatttctctcagtttataactgaaagttttacattatactgcaagaggaaaagg
agagacaaggtttatggcaacaatgttgagatccaagcatttgcagagatgtacaatcgt
cccattcacatatattcctacagtacagagccaattaacatttttcaaggaagctacaac
acagacactcctccaattaggttaagttaccatcatggtaatcattacaattcagtggtt
gatccccgccgacagactattggggcaggccttggatttagctcttttagagggactaat
gttgacagggatcaggtgaaggctgcaataaaagctcagcaagaccagcaaattgataat
gcactgatggcagaagggcgattctactctgatctggagttaacagagagggaaatagaa
cggatggtgatggaagcctcgcgttcagaatatctggccaaggagaaaaagcttaacata
agggaatcatcgacatcaggggcagaaccatcttcatccgctgcaattagtggttcctct
cgatcagttgctggagcggacagaagcagcgaggactactttgtgcttccagacaccgta
cttactcgcagcatgcagctgcttctcgcaatgggcttcggctacaaccaggtcatggag
gcctacagcatattcggcgaggatgtggactcgatggtctgctacctggtggagaccgga
ggagcctcggcaggtggtagcaatcgccggaaaggaaaggctgctgagtga

DBGET integrated database retrieval system