KEGG   Zea mays (maize): 100285430Help
Entry
100285430         CDS       T01088                                 

Definition
cysteine-type peptidase
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 536 aa AA seqDB search
MTRIFVQRGTAGSSSSSGRSGSQSAQQPAAAAREELPLQPQPQLPELLAIDDIAEHLNEG
NENNSSRIKFLRTDDTISESSSYAEERAAREKPPNDDSNVINPTSLVEEPIVLHTPDQIE
HGNSVPSGTNSSQMVGAASHPPPPPAPPPKPLLGNSGLWRMGPGSSNSVRIGSPRRPVAW
PPVAARTSASGSRPSSPRSLIDGEGYNSADEQGPCYASSYDDSERERMFEHDLRRVKGLE
IRKTAEDGNCLFRAVADQVYGDAEAYDMARQMCVDYMERERDHFSQFITESFTLYCKRKR
RDKVYGNNVEIQAFAEMYNRPIHIYSYSTEPINIFQGSYNTDTPPIRLSYHHGNHYNSVV
DPRRQTIGAGLGFSSFRGTNVDRDQVKAAIKAQQDQQIDNALMAEGRFYSDLELTEREIE
RMVMEASRSEYLAKEKKLNIRESSTSGAEPSSSAAISGSSRSVAGADRSSEDYFVLPDTV
LTRSMQLLLAMGFGYNQVMEAYSIFGEDVDSMVCYLVETGGASAGGSNRRKGKAAE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggatcttcgtgcagcgcgggaccgccggctcctcgtccagctccggccgctcg
ggctcgcagtcagcgcagcagccggcagcagctgcccgggaggagttgccgttgcaacct
cagccacagctaccagaactattggctatagatgatatagctgagcatttaaatgagggc
aacgagaacaacagtagcagaattaagtttttgaggacagatgacaccatttcagagagc
tcgagctacgcagaggagagggctgccagggagaagcctcctaacgatgactctaatgta
atcaaccccacttccttggtagaggaaccgatagtgctccatacccctgatcagattgaa
catggaaattctgtgccgtcaggaactaattcatcacagatggtgggtgcagcatcgcac
ccgccgccaccgccagctccgcctccaaaaccattgttggggaatagtgggttgtggaga
atgggacctggaagttccaacagtgtgcggattggatctccaagaagaccggtagcttgg
ccaccagtggcagctcggacatctgcttcaggttctcgtccttcttcgcctaggtcactc
attgatggtgaaggttacaatagtgctgatgaacagggtccctgttacgcctcgagttat
gatgattcggaaagagagcgtatgtttgagcatgacctaaggcgagtgaaagggttggaa
atcagaaagacggccgaagatgggaactgtctattcagagctgttgctgatcaagtttat
ggagatgcagaagcttatgacatggctaggcagatgtgtgttgattatatggaaagggaa
cgggatcatttctctcagtttataactgaaagttttacattatactgcaagaggaaaagg
agagacaaggtttatggcaacaatgttgagatccaagcatttgcagagatgtacaatcgt
cccattcacatatattcctacagtacagagccaattaacatttttcaaggaagctacaac
acagacactcctccaattaggttaagttaccatcatggtaatcattacaattcagtggtt
gatccccgccgacagactattggggcaggccttggatttagctcttttagagggactaat
gttgacagggatcaggtgaaggctgcaataaaagctcagcaagaccagcaaattgataat
gcactgatggcagaagggcgattctactctgatctggagttaacagagagggaaatagaa
cggatggtgatggaagcctcgcgttcagaatatctggccaaggagaaaaagcttaacata
agggaatcatcgacatcaggggcagaaccatcttcatccgctgcaattagtggttcctct
cgatcagttgctggagcggacagaagcagcgaggactactttgtgcttccagacaccgta
cttactcgcagcatgcagctgcttctcgcaatgggcttcggctacaaccaggtcatggag
gcctacagcatattcggcgaggatgtggactcgatggtctgctacctggtggagaccgga
ggagcctcggcaggtggtagcaatcgccggaaaggaaaggctgctgagtga

DBGET integrated database retrieval system