KEGG   Zea mays (maize): 100285517Help
Entry
100285517         CDS       T01088                                 

Gene name
cl35046_1b
Definition
LOC100285517
Orthology
K10295  
F-box protein 9
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 335 aa AA seqDB search
MKIQQRTWAFSNDISVDIRPDINSFDHFLSMRYIATDRPWLKLYGIRVQPVPPFSSLSYK
PDPALIHHCLPDELMLEIFTRMSPYTLGRAACVCRKWKYTARNPTLWRAACLKTWQRSGM
EANYMMVRSLYDSSWRRMWLQRPRIRIDGLYVSRNTYIHTGVTEWQFKKTVNVVCYYRYL
RFFPSGKFLYKISPDKVKDAVKCMHFRASKADCVFKGDYVLSEDGQIEMALLYPGHRYTL
VRMHLRLRGTTVGANNRLDVLKILTTGVNATELQNWKGSILELVQGWEEDETHDPDVPAV
SHSRGLSPFVFVPFEEADTSLLNLPVEKMDYYVPG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccaacagagaacctgggcattttcaaatgatatctctgttgatattcgtcct
gacataaactcatttgatcattttttaagcatgcgatacattgcaacagatagaccctgg
ctgaaattatatggaataagagttcagcctgtgccaccattcagcagtttgagctacaaa
cctgatccagcgctcattcatcattgcctacctgatgaactaatgctcgagatttttaca
agaatgagcccatatactttagggagggctgcatgtgtctgccgcaagtggaaatatact
gcacgcaatcctactttgtggcgtgctgcatgcttgaaaacttggcagaggagtggaatg
gaggcaaactacatgatggttcggtcgttgtatgattcctcttggaggagaatgtggcta
cagagaccaagaatccgaattgatggtctctatgtaagcaggaacacatacattcatact
ggagttacagaatggcaattcaagaaaactgtcaatgtggtttgctactaccgttactta
agatttttcccgagcgggaagtttctctataagatctctccagataaagttaaagacgct
gttaagtgcatgcatttccgggcatcaaaggctgattgtgtatttaaaggtgactacgtg
ctgtcagaggatggccagatagaaatggctctcctgtacccagggcatcggtacacgctt
gtcaggatgcaccttaggcttaggggcaccacagttggtgcaaataacaggttggatgta
ctgaagattctaaccaccggagtgaatgcaactgagctgcaaaactggaaaggaagcata
ctagaactcgttcagggctgggaggaggatgagacgcatgacccggatgtgcctgccgtt
tcccacagcaggggtttgtcaccctttgtgtttgttccgtttgaggaggctgatacttcg
ttgttaaacctccccgtggagaagatggactactacgtccctgggtga

DBGET integrated database retrieval system