KEGG   Zea mays (maize): 100285574Help
Entry
100285574         CDS       T01088                                 

Gene name
cl6880_1
Definition
LOC100285574
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
zma  Zea mays (maize)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:zma00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 497 aa AA seqDB search
MRAPRHGSMRAHVALAFAALVLAGDALHPALAGGCGFDYKDALSKTIIFLEAQRSGKLPR
SNRVKWRGDSGLDDGKLANVDLTGGYYDAGDNVKYGLPLAFTVTTLAWTALAFKPELEST
KELKHVHQAIKWGTDYLLKCAARKNKLWVQFGDPNLDHQCWVRPENMKAPRTLYEIDSKT
PGTEIAAETSAAFAASSMVFRDDKKYSRNLLNKAKLLFTFAKSHLGSYDGECPFYCSYSG
YNDELLWAATWLYLATRRQVYADFIAHEAISSSVAEFSWDLKFPGAQVLLAEFNMTSAGG
AQNFKSQADNFVCAVLPDTAFHQVFITPGGVIHLRDGANSQYVTSTAFLLVVYADLLLRT
GQTVLCGNQPLPPARLHEFARQQMDYLLGANPRHSSYVVGFGANPPTQPHHRGASTPVLP
PGTDVNCGLSFGDWMAPDKPNPNELTGAIVGGPDKNDGFVDKRGNSSYTEPCTYINSLAI
GPLAALAVRGVQLVATQ
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcaccgaggcacggcagcatgcgcgcccacgtcgccctggccttcgcggcgctg
gtgctggccggcgacgccctgcacccggcgctggccggcggctgcggcttcgactacaag
gatgccctcagcaagaccatcatattcctggaggcgcagcgctccgggaagctgccgcgc
agcaaccgcgtcaagtggcgcggcgactccgggctcgacgacggcaagctcgccaatgtg
gatctcaccggcggatactacgacgccggcgacaacgtsaagtacgggctcccgctggcg
ttcacggtgacgacgctggcgtggacggcgctggcgttcaagcccgagctggagtcgacc
aaggagctgaagcacgtgcaccaggccatcaagtggggcaccgactacctgctgaaatgc
gccgccaggaagaacaagctgtgggtgcagttcggcgatcccaacctggaccaccagtgc
tgggtgcgtccggagaacatgaaggcgccgcgcacgctgtacgagatcgactcgaagacg
cccgggacggagatcgccgccgagacgtcggccgcgttcgccgcctcgtccatggtgttc
cgcgacgacaagaagtactcgcgcaatctgctgaacaaggcgaagctgctgttcacgttc
gccaagagccacctgggcagctacgacggcgagtgccccttctactgctcctactcgggc
tacaacgacgagctgctgtgggccgcgacctggctgtacctggcgacgaggcggcaggtg
tacgcggacttcatcgcccacgaggccatctcgtcgagcgtggccgagttcagctgggac
ctcaagttccccggcgcgcaggtgctgctggccgagttcaacatgacctcggcgggcggc
gcgcagaacttcaagtcgcaggcggacaacttcgtgtgcgcggtgctgccggacacggcg
ttccaccaggtgttcatcaccccgggcggcgtgatccacctccgcgacggcgccaactcg
cagtacgtgaccagcacggcgttcctgctggtggtgtacgcggacctgctgctgcggacg
gggcagacggtgctgtgcgggaaccagccgctgcccccggcccggttgcacgagttcgcg
cggcagcagatggactacctgctgggcgccaacccgcggcacagctcctacgtcgtgggc
ttcggcgccaacccgcccacgcagccgcaccaccgcggcgcatccacccccgtgctgccc
cccggcacggacgtcaactgcggcctcagcttcggggactggatggcgcccgacaagcca
aaccccaacgagctcaccggcgccatcgtcggcgggcccgacaagaacgacggcttcgtc
gacaagcgcggcaactcctcctacaccgagccctgcacctacatcaactccctcgccatc
ggcccgctcgccgcgctcgccgtccgaggcgtgcagctygtcgccacgcagtga

DBGET integrated database retrieval system