KEGG   Zea mays (maize): 100285629Help
Entry
100285629         CDS       T01088                                 

Definition
phospholipid hydroperoxide glutathione peroxidase 1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
zma  Zea mays (maize)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100285629
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100285629
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100285629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 227 aa AA seqDB search
MAPSFTSLLSAANSAAASRLPSAAAGRASTFVRFPHHPTGWAGASVAAPRTARKRAPGVA
YATAATEKSIYDYTVKDIDGKDVPLKKFKNKXLLIXNVASQXGLTTANYTELSHIYEKYK
TQGFEILAFPCNQFGAQEPGSNTQIKQFACTRFKAEFPIFDKVDVNGPXTAPIYKFLKSS
AGGFLGDLVKWNFEKFLVDKNGKVIERYPPTTSPFQIEKDIQKLLAA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggctccctcgttcactagcctcctctcggccgcgaactccgccgccgcctcgcggctc
ccctcggccgccgccggacgggcatccactttcgtgcgcttcccgcatcacccgacgggc
tgggctggggcctccgtcgcggcgccgcgtacggcgcgcaagcgggcacccggcgtcgcc
tacgccaccgcagctaccgagaagagcatctacgactacaccgttaaggacattgatgga
aaagatgttcctcttaaaaagttcaagaataaggkgttgctgattgktaacgttgcttct
caatgkgggttgacaacagcaaattacactgaactatctcatatctatgagaagtacaag
actcaagggtttgagatccttgcatttccttgcaatcaatttggtgcacaagaacctgga
tcaaatactcagattaagcagtttgcatgtacaagattcaaagctgaatttccgattttt
gacaaggttgatgtcaatggacctaawacagctcccatctataaatttytgaagtccagt
gctggaggatttttgggtgatctcgtgaaatggaattttgaraagttcttagtggataag
aatggcaaagtcattgagagatatccmccaacaacttcacctttccagattgagaaggac
atccagaaactgctcgcggcataa

DBGET integrated database retrieval system