KEGG   Zea mays (maize): 100285641Help
Entry
100285641         CDS       T01088                                 

Definition
acyl-protein thioesterase 1 (EC:3.1.1.5)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
zma  Zea mays (maize)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100285641
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100285641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 264 aa AA seqDB search
MSSLIRLLFTLAAAIGAASLLVASLRRRAPPPGLPAKLVPSSHMAGRNRSFVLWLHGLGD
SGPANEPIRNLFSAPEFRLAKWSFPSAPRAPVSCNNGFVMPSWFDIHELPMSAGSPQDET
GVLKAVEKVHAMIDREVADGIHPENIFVCGFSQGGALTLASVLLYPKKLGGGAVFSGWVP
FSSSVTERISPEANKTPFLWSHGMADKVVLFEAGQAGPPFLQSAGVNCEFKAYPDLGHSL
SQEELLYLESWIKSRLNASQEKDG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcctgatccgcttgctcttcaccctcgccgcggccatcggcgcggcctcgctc
ctcgtcgcctcactccgccgccgcgcgccgcctcccgggcttcccgccaagctcgtcccc
tcctcccacatggcaggacgcaaccggagtttcgtgctgtggctgcacggcctcggcgac
tcaggcccggccaacgagcccatccgcaacctcttctccgccccggagttccggctcgcc
aagtggtcgttcccctccgctccccgcgcccccgtatcatgcaacaatggttttgtcatg
ccgtcgtggttcgatatccacgagcttcccatgagcgctggctctccgcaagatgagact
ggggttctcaaggctgtggaaaaggtgcacgccatgatagacagggaagtagccgatggc
atccaccctgagaacatatttgtttgtggatttagtcaaggaggtgctctgacattagct
agtgttttgctttatccgaagaagttaggtggaggagcagtgttcagtgggtgggtacct
ttcagttcatcagtcactgagaggatttcacctgaagcgaataagaccccgtttctttgg
tcacatggaatggctgacaaagtagtattgtttgaagctggccaggctggtccaccgttt
ttgcaaagcgcgggtgttaactgtgaattcaaggcatatccagatctgggccattcgctt
tcccaagaagagctactttatcttgagtcgtggatcaagagtcgtctaaatgcctctcaa
gagaaggacggctaa

DBGET integrated database retrieval system