KEGG   Zea mays (maize): 100285945Help
Entry
100285945         CDS       T01088                                 

Definition
glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
zma  Zea mays (maize)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Class
Metabolism; Overview; Fatty acid metabolism [PATH:zma01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:zma00071]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:zma00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 723 aa AA seqDB search
MAAKGRTELDVGADGVAVITIYNPPVNSLSIDVLHSLKESYEEALRRNDVKAIVVTGKGG
KFSGGFDISSFGGVQGGQTMQPKVGYIAIDILTDTVEAATKPSVAAIDGLALGGGLEVAM
ACHARIATPTAQLGLPELQLGIIPGFGGTQRLPRLVGLTKSLEMMLLSKPIKGGEAHQLG
LVDALVSPNDLVNTARQWALDIYECRRPWIKSLYKTDKLEPLGEAREILKFARAQAQKQA
ANLHHPLVCIDVIEEGIVAGPRAGLWKEATSFQELLFSDTCKSLVHVFFSQRATSKIPGA
TDLGLMPRKITKVAILGGGLMGSGIATAMVLSNYPVLLKEVNEKFLTAGINRIQANLQSR
VRKGKMTDERYEKAMSLVTGVLDYERFKDVDLVIEAVIENVKLKQQIFSDLEKYCPSHCI
LATNTSTIDLNLIGEKTKAQDRIAGAHFFSPAHVMPLLEIVRTQHTSPQVVVDLLDVGKK
IKKTPIVVGNCTGFAVNRMFFPYTQSALFYVDLGMDVYKIDRACTKFGMPMGPFRLADLV
GFGVAVATGMQYLENFPERVYKSMLLPLMMEDNRAGEATQKGFYKYEGKRKATPDPEIMK
YIEKSRSMAGVTPDPELMKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGM
GFPPYRGGVMHWADSIGAKYIHGKLEEWTKRYGGFFKPCSYLAERAAKGIPLSAPTKKVQ
ARL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaaggggaggacggagctggacgtgggcgccgacggcgtggccgtaatcacc
atctacaatccgcccgtcaactcgctctccatcgacgtcttacatagcttaaaagaaagc
tatgaagaagcacttcggagaaacgatgttaaagctattgtcgttacagggaaaggaggg
aaattttctggaggatttgatattagttcctttggtggtgttcaaggaggccaaacaatg
caaccaaaggttggctacatagcaatagatattctcacagatactgtagaagctgcgaca
aagccatcagtggcagcaattgatggtcttgctcttggtggaggtttagaagttgccatg
gcatgccatgcacggattgcaactccaacagctcaattaggtcttccagaacttcagtta
ggaattattccaggatttggaggaacacagcgactcccacgactggttggtctgacaaaa
tctttggaaatgatgctgttatctaagccaatcaagggcggtgaggcacaccaactgggc
ctggttgatgccttagtttctcctaatgatttggtgaatactgctcgtcaatgggctttg
gatatatatgaatgtaggaggccctggatcaaaagcctttataagactgacaagctagaa
cctcttggggaggctagggaaattctgaagtttgcaagagctcaagctcaaaagcaggca
gctaatcttcatcacccacttgtttgtattgatgtcattgaagaaggtatagttgcagga
ccacgggctggactctggaaggaagcaacttctttccaggaactgcttttctcagatact
tgtaaaagcttagttcatgtgttcttttctcagcgggcaacgtctaagattccaggtgct
acagacttggggttgatgcctaggaaaataactaaagttgccattctaggtggtgggctt
atgggttcaggaattgcaactgcgatggtattaagtaactatcctgtgctacttaaagaa
gtaaatgagaagttcctaactgctggaatcaacagaatccaagccaatttgcagagtcga
gtaaggaaaggaaaaatgaccgatgagcgatatgagaaggctatgtctctcgttactggt
gtccttgattatgaacgtttcaaagatgtagacctcgttatagaggcagttattgagaat
gtgaagttgaagcagcaaatattttctgacttagagaagtactgtccttcacattgcatc
cttgctactaacacatctacaattgatcttaatctgattggggagaaaacaaaggctcaa
gatcgtattgctggtgcacacttctttagtcctgcgcatgtgatgccacttctggaaata
gttcgtactcagcacacttcaccacaagttgttgttgacttgctggatgttgggaagaag
attaaaaagacaccaatagtcgtcgggaactgtactggctttgcagttaataggatgttc
tttccatacactcaatcagcactcttttatgttgatcttggtatggatgtttataagatt
gatcgtgcttgtaccaaatttggaatgcctatgggtcctttcagactggcagatctggtt
ggttttggtgtggctgtggccactggtatgcaataccttgaaaatttcccagagagggtc
tacaaatcaatgctacttcctctgatgatggaggacaatagggcaggtgaagccacccaa
aaaggattttacaagtatgagggcaagaggaaagcgactcctgatcctgaaattatgaaa
tatattgaaaaatctaggagcatggcaggagttacaccagatcctgagctgatgaagcta
agtgagaaagacatagtcgagatggtgtttttcccggtgataaatgaagcctgccgagtc
cttgatgagggtatcgccgtcaaggcttctgacctagacatcgcttcgatcttcggcatg
gggttcccaccttataggggaggtgtcatgcactgggcagattccatcggcgcaaagtac
atccatggaaagttggaggagtggacaaagcggtatgggggcttcttcaagccctgctct
tacctcgctgaaagagctgcaaaagggattcctctgagtgcaccaacaaagaaagttcag
gctcggctataa

DBGET integrated database retrieval system