KEGG   Zea mays (maize): 100286018Help
Entry
100286018         CDS       T01088                                 

Gene name
umc1821
Definition
LOC100286018
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
zma  Zea mays (maize)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100286018 (umc1821)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100286018 (umc1821)
   00670 One carbon pool by folate
    100286018 (umc1821)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     100286018 (umc1821)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     100286018 (umc1821)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
4
AA seq 523 aa AA seqDB search
MALTAAPASGDSQSGPQRNYQVVVAATCDMGIGKGGVLPWKLLGDLKFFKELTLTTTDPA
KKNAVIMGRKTWESIPVKSRPLPGRLNVILTRSGSFDFATVENVVICGSMKSALELLAST
PYCLSIEKVFVIGGGQVLRDYLNGPACEAIHLTDIQSSIECDTFIPPVDFSVFQPWYSSF
PVVESNIRHSFVTFVRVRKSVAETHESNGKELTEIDTKNDKFEIENFSFLPKMVHDRHEE
YQYLNLVEDIIRFGAQKNDRTGTGTLSKFGCQMRFNLRKIFPLLTTKRVFWRGVVEELLW
FISGSTNAKVLQEKGIHIWDGNASREYLDRIGLAHREEGDLGPVYGFQWRHFGAEYTDMH
ADYTGKGFDQLMDVIDKIKNNPDDRRIILSAWNPSDLKKMALPPCHMFAQFYVENGELSC
QMYQRSADMGLGVPFNIASYSLLTYMIAQVCDLSPGDFVHVIGDAHVYRNHVRALEEQIQ
KMPKPFPILKINPSKKDIDSFMASDFKLVGYDPHQKLEMKMAV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcactgactgcagctccagccagtggtgattcacagagtggtcctcagaggaactat
caggttgttgttgctgccacttgtgacatgggcattggcaagggtggggtattgccatgg
aagcttcttggtgatcttaaattcttcaaagaacttacactaactacaactgatcctgcc
aaaaagaatgcagttataatgggaaggaaaacatgggagagcattcctgttaagtcaagg
ccactgcctggtcgtttgaatgtcatacttactcgatctggtagttttgattttgcaaca
gtagagaatgttgttatatgtggaagtatgaaatctgccttagagctgctagcatcaact
ccatactgcttatcaattgagaaagtttttgtcataggaggtgggcaggtactgagagat
tatttgaatggacctgcatgtgaggctatccatctgactgatattcagtcaagcattgag
tgtgatactttcatccctccagttgacttctcagtgttccagccttggtattcatctttc
ccagtggtagagagcaacattaggcattcttttgtgacttttgttcgtgttagaaagtca
gtggcagaaactcatgagtcaaatggcaaggaattaactgagattgataccaagaatgac
aaatttgaaatagagaatttctcttttctccccaagatggtacatgaccgccatgaggag
tatcaatatctcaatcttgttgaagatattataaggtttggtgctcagaaaaatgacagg
acaggaactggaacattgtcaaaatttgggtgtcagatgcgattcaacttaaggaaaatt
tttcctctgctgacaacaaagagggtattttggcgtggtgttgtcgaagaactcctttgg
ttcatcagtggctcaacaaatgcaaaggttttgcaagagaagggtattcatatctgggat
ggcaatgcttcaagagagtatcttgaccgtattggcttggcacacagggaggaaggtgat
ctaggtccagtttatggatttcaatggcggcactttggtgctgaatacactgacatgcac
gctgactatactggaaaaggctttgatcagctaatggatgtgattgacaagattaagaac
aatcctgatgaccgccgaataattttatcggcgtggaatccttcagatctcaagaagatg
gctcttcctccttgccacatgtttgcacaattttatgtggagaacggggagctatcctgc
cagatgtatcaacgctctgcagacatggggcttggtgttccattcaacatcgcatcatat
tctcttttgacgtacatgattgctcaagtttgtgatctttctccaggagattttgtccat
gttataggggatgctcatgtctatagaaatcacgttcgagctctggaggaacagattcag
aagatgcctaaaccatttccaattttaaagataaatccttcgaaaaaggatatagattct
ttcatggcgtcagacttcaagctggttggctatgatcctcaccagaagctagagatgaaa
atggcagtgtaa

DBGET integrated database retrieval system