KEGG   Zea mays (maize): 100286064Help
Entry
100286064         CDS       T01088                                 

Gene name
umc1286
Definition
LOC100286064
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
zma  Zea mays (maize)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100286064 (umc1286)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100286064 (umc1286)
    2.7.1.82  ethanolamine kinase
     100286064 (umc1286)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 366 aa AA seqDB search
MVAIENQNQSQAAVAVAAEAVPAPASRIPREARRLLHELAAAWADVADCRALEVVPLKGA
MTNEVYQARWLTAGPAGQKEEPRAEREVRKVLVRIYGDGVDLFFDREDEVRTFECMSRHG
QGPRLLGRFPNGRVEEFIHARTLSAADLRDPEISALVASKLREFHNLDMPGPKSVLIWDR
LRNWLRTAKSLCPPEEAKEFRLDSLENQITALENECSGDYQWIGFCHNDLQYGNIMIDEE
TNVLTIIDYEYASFNPVAYDIANHFCEMAADYHSSKPHILDYSRYPDVDEQKRFVKTYLN
ISGEEPDAEVVENLLQSIEKHTLSSHLVWGLWGIISDHVNDIDFDYKEYARQRFEQYWHK
SAILTS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgatcgagaaccagaaccagagccaggccgcggtggcggtggcggcggaggcg
gtgccggcgccggcgtcgcggatccccagggaggcgcggcgcctgctgcacgagctggcg
gcggcgtgggcggacgtggccgactgccgcgcgctggaggtcgtgccgctcaagggggcc
atgaccaacgaggtctaccaggcgcgctggctcactgcaggccctgccggccagaaggag
gagcccagggcggagagggaggtgaggaaggtgctcgtgcggatttacggcgacggcgtc
gacctcttcttcgaccgcgaggacgaggtgcgcaccttcgagtgcatgtcacgccatggc
cagggtccccgcctcctcggccgcttcccgaacggccgcgtcgaggagttcatccacgca
aggacattgtcagctgccgaccttcgcgatcctgaaatttcagctctggtggcttccaag
ctgagggagttccacaaccttgacatgcctggtcccaaatctgtgctcatttgggacaga
cttaggaactggctcagaactgccaagagcttgtgtccacctgaagaagccaaggaattt
cggttggacagtctggagaaccagattactgcattggagaacgagtgttcaggtgattac
cagtggattggtttctgtcacaatgatcttcagtatggcaatatcatgattgatgaagag
accaacgtgctgaccatcattgattatgagtatgcaagcttcaacccagttgcatatgac
attgctaaccatttctgtgagatggcagcagactatcattcatcaaagcctcatatactg
gactacagcagatatccagatgttgatgagcagaagcgttttgttaagacctacctgaac
atttctggtgaggaacctgatgcggaagttgtagagaacctgctccaaagcattgagaag
cacacgctctccagccatctagtatggggcctctggggaataatttcggaccatgttaac
gacattgacttcgactacaaggagtatgcgaggcagagattcgagcagtactggcacaag
tctgcgatcttaacatcttga

DBGET integrated database retrieval system