KEGG   Zea mays (maize): 100286258Help
Entry
100286258         CDS       T01088                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
zma  Zea mays (maize)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:zma01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:zma00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 386 aa AA seqDB search
MESSMSMSAAASVVVRTCVPAAVMLPLSPSFTRPALRTTGRGFRCRCSSATKDSAVVYSR
LLDDALFRSAEVIQWESGKSMNAIATAQGIQIRRRCRPRYPSEGTGAERAVPRNILEQII
WDKEVEVAQRKARTPLCEVKASAALAPPPRDFVGALRAACRRNAVPALVAEVKKASPSKG
LLRDHFDPVEIARTYEKNGAACLSILTDEKHFQGSFENLEAVRSSGINCPLLCKEFVIDA
WQIYYARSKGADAVLLIAAVLPDIDITYFLRVCKSLGMAALVEVHDERELDRVLKIDGVE
LIGINNRSLGTFEVDTANTNMLLEKRGDIINEKRIQVVSESGLFTPDDVAYVQKAGVFAV
LVGESLLTQEDPGRAIAGLFGKELLP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgtccatgtccatgtccgccgccgcctcggtcgtcgtgaggacatgcgttccg
gccgctgtcatgttgcccctctcaccgtcctttactaggcccgccctccgcaccaccggg
cgaggcttccgctgcaggtgcagcagcgccaccaaggactcggcggtcgtgtacagcagg
ctgctggacgacgcgctgttccggtcggcggaggtgatccagtgggagagcggcaagtcc
atgaacgccatcgccacggcgcagggcatccagatccggcggcgctgccggcccaggtac
ccgtccgagggcaccggcgccgagcgcgccgtcccgcgcaacatcctggagcagatcatc
tgggacaaggaggtggaggtggcccagcgcaaggccaggacgccgctgtgcgaggtgaag
gcgtccgccgcgctcgcgccgccgcccagggacttcgtcggcgcgctgcgcgccgcgtgc
cgccgcaacgccgtccccgcgctcgtcgccgaggtcaagaaggcgtcgcccagcaagggc
ctcctcagggaccacttcgacccggtggagattgctcgcacctacgagaagaacggcgcg
gcgtgcctgagcatcctgaccgacgagaagcacttccaggggagctttgagaacctagag
gccgtacgcagctccggtataaactgccctctgctctgcaaggagttcgtcatcgacgcc
tggcagatctactacgcgcgctcgaaaggcgcggacgcggtcctcctgatcgcggccgtg
ctgccggacatcgacatcacctacttcctccgcgtctgcaagagccttgggatggcagct
cttgtcgaggttcatgatgagagggagttggatcgcgtcctcaagatagacggtgtggag
ctcatcggcatcaacaaccgcagtcttgggacattcgaagtcgacactgcaaacacaaac
atgctgttagagaagcgtggcgacatcattaacgagaagcgaatacaggttgtgagcgag
tctgggctgttcactcccgatgacgtggcatatgtgcaaaaagctggtgttttcgcggtt
ttggtaggagagtccctgctgacgcaggaagaccctggccgagcgattgctgggctgttc
gggaaggagctgttaccttaa

DBGET integrated database retrieval system