KEGG   Zea mays (maize): 100286386Help
Entry
100286386         CDS       T01088                                 

Gene name
MPK7
Definition
ABA stimulation MAP kinase
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
zma  Zea mays (maize)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:zma00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    100286386 (MPK7)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100286386 (MPK7)
Protein kinases [BR:zma01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100286386 (MPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 397 aa AA seqDB search
MDGGGQPPDTEMTDAGAGGGGQPSPPQQPASGAGMMENIHATLSHGGRFIQYNIFGNVFE
VTSKYKPPILPIGKGAYGIVCSALNSETAEQVAIKKIANAFDNKIDAKRTLREIKLLRHM
DHENIVAIRDIIPPPLREAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGL
KYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARTTSETDFMTEYVVTRWYRAPELLLN
SSEYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPNEADLDFVNENARR
YIRQLPCHARQSFPEKFPHVQPLAIDLVEKMLTFDPRQRITVEGALAHPYLASLHDISDE
PVCSMPFSFDFEQHALSEEQMKDLIYQEALAFNPDYQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggacggcggggggcagcccccggacacggagatgacagacgccggcgcgggcggcggg
gggcagccttcgccaccgcagcagccggcgagcggggccgggatgatggagaacatccac
gcgacgctcagccacggtggccgcttcatccagtacaacatcttcggcaacgtgttcgag
gtcacctccaagtacaagccccccatcctccccatcggcaagggcgcctacggcatcgtc
tgctcggcgctcaactccgagacggcagagcaggtggccatcaagaagatcgccaacgcc
ttcgacaacaagatcgatgccaaacgcacgctccgcgagatcaaactgctccgccacatg
gaccacgagaatattgttgcaataagagatatcatacctcctccattgagggaggcattc
aatgatgtgtatattgcctatgaattgatggatactgatctgcatcaaattattcgttca
aatcaagctttgtcagaggagcactgtcagtattttctttatcaaattcttcgtggcttg
aagtatatacattcagcaaatgttcttcaccgtgatttgaagcctagcaatcttcttttg
aatgcaaactgtgacctcaagatatgtgattttgggcttgctcgcaccacctcagaaact
gattttatgactgaatatgttgtcacaagatggtatagagcaccagagcttttattgaac
tcctctgaatatactgctgccattgatgtgtggtctgtgggctgtatatttatggaactg
atggaccgaaaacccttgtttcctggaagagaccatgtccatcagctacgtctactaatg
gagctcattggaacaccgaatgaggctgatcttgattttgtaaatgaaaatgcaagaaga
tatatccgccaacttccctgtcatgctagacagtccttccctgaaaaatttccacatgta
caacctttagcaattgacctagtggaaaagatgctaacttttgatcctagacagagaata
actgttgaaggcgcacttgcacacccttacttggcatcacttcatgacataagtgatgag
ccagtctgctcaatgcccttcagcttcgacttcgagcagcatgcattatctgaagaacag
atgaaggatctgatctaccaagaggctcttgcattcaacccagattaccagtag

DBGET integrated database retrieval system