KEGG   Zea mays (maize): 100304209Help
Entry
100304209         CDS       T01088                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
zma  Zea mays (maize)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:zma01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:zma00340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 476 aa AA seqDB search
MGSLHALRAPTPLVGSTRIGFSSGLRFCSNRVLRGLTPIGAMKSYRLSELSDTEVSGLKA
RPRIDFSSIFGTVNPIVEDVRVRGDAAVKHYTEKFDKVMLDDVVVCVSDLPDAELDPAVK
EAFDVAYDNIYAFHVSQKIPEKTVENMKGVRCKRITRCIGSVGLYVPGGTAVLPSTALML
AVPAQIAGCKTIVLATPPSRDGSICKEVLYCAKKAGVTHILKAGGAQAISAMAWGTASCP
KAEKIFGPGNQYVTAAKMILQNSEAMVSIDMPAGPSEVLVIADKYANPVHVAADLLSQAE
HGPDSQVVLVVAGDGVDLGAIEAEVSKQCNALPRGEFASKALSHSFTVFAKDMVEAISFS
NLYAPEHLIINVKDAEQWEEFIENAGSVFLGQWTPESVGDYASGTNHVLPTYGYARMYSG
VSLNSFLKYITVQSLTEEGLRKLGPYVAKMAEVEGLEAHKRAVTLRLQEVEANVTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcttgcatgctctgcgggcgccgacgccgctcgttgggagcactaggattggc
ttcagttcggggctccgcttttgctccaacagagtcctcagagggttaactcccattggc
gcgatgaagtcgtataggctatcggagctcagcgacaccgaagttagcggcctcaaagct
cgtccccgcatcgatttctcatctatttttggcacggtgaatccaatcgttgaagatgtc
cgtgtgagaggtgatgcagcagttaagcactacacagaaaagtttgacaaggtcatgctt
gatgatgttgtcgtctgtgttagcgatcttccagatgcagagcttgatccagctgtgaag
gaagcctttgatgttgcatatgacaatatatatgccttccatgtttcacaaaaaatacct
gagaagacagttgaaaatatgaaaggcgtaagatgtaagagaataactagatgcattggt
tctgttgggctgtatgtcccaggtggcactgcagtcttgccttcaactgcattgatgctt
gctgtgcctgcacagattgctggatgcaaaactattgttcttgccacaccacctagccgt
gatggtagcatatgcaaggaggttctttactgtgcaaagaaagctggtgtgacacacata
ttgaaagctggaggagctcaggcaatctcagcaatggcatggggaactgcatcttgccca
aaggctgagaagatttttggacctggtaaccagtatgtaacagctgccaaaatgattctt
cagaacagtgaagctatggtatctatagacatgcctgctggcccttctgaagttttagtc
attgctgataaatacgcgaacccagttcatgttgctgctgatctgctatcccaggcagaa
catggcccagatagtcaggttgttctagttgttgctggagatggtgttgatctgggtgcc
attgaggcagaagttagcaagcagtgcaacgcgcttccaagaggtgaattcgcttcaaaa
gcacttagccacagcttcactgtgttcgcgaaagatatggttgaggcgatatcattctca
aatctgtatgcccctgagcatttgatcatcaacgtaaaggatgctgagcagtgggaggag
ttcatcgaaaacgcagggtcagttttcttgggccaatggaccccagagagcgtgggcgat
tatgcgagcgggacgaaccatgtccttccgacctatggttacgcaaggatgtacagcggt
gtatcgctgaactctttcctcaaatacatcactgtccaatccctaacagaggaagggctg
agaaagctggggccgtacgtcgcgaagatggccgaagtggaggggctagaggcgcacaag
agagccgttacccttaggctgcaagaggttgaggccaatgtaactgtctag

DBGET integrated database retrieval system