KEGG   Zea mays (maize): 100304209Help
Entry
100304209         CDS       T01088                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
zma  Zea mays (maize)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100304209
  Amino acid metabolism
   00340 Histidine metabolism
    100304209
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     100304209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 476 aa AA seqDB search
MGSLHALRAPTPLVGSTRIGFSSGLRFCSNRVLRGLTPIGAMKSYRLSELSDTEVSGLKA
RPRIDFSSIFGTVNPIVEDVRVRGDAAVKHYTEKFDKVMLDDVVVCVSDLPDAELDPAVK
EAFDVAYDNIYAFHVSQKIPEKTVENMKGVRCKRITRCIGSVGLYVPGGTAVLPSTALML
AVPAQIAGCKTIVLATPPSRDGSICKEVLYCAKKAGVTHILKAGGAQAISAMAWGTASCP
KAEKIFGPGNQYVTAAKMILQNSEAMVSIDMPAGPSEVLVIADKYANPVHVAADLLSQAE
HGPDSQVVLVVAGDGVDLGAIEAEVSKQCNALPRGEFASKALSHSFTVFAKDMVEAISFS
NLYAPEHLIINVKDAEQWEEFIENAGSVFLGQWTPESVGDYASGTNHVLPTYGYARMYSG
VSLNSFLKYITVQSLTEEGLRKLGPYVAKMAEVEGLEAHKRAVTLRLQEVEANVTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcttgcatgctctgcgggcgccgacgccgctcgttgggagcactaggattggc
ttcagttcggggctccgcttttgctccaacagagtcctcagagggttaactcccattggc
gcgatgaagtcgtataggctatcggagctcagcgacaccgaagttagcggcctcaaagct
cgtccccgcatcgatttctcatctatttttggcacggtgaatccaatcgttgaagatgtc
cgtgtgagaggtgatgcagcagttaagcactacacagaaaagtttgacaaggtcatgctt
gatgatgttgtcgtctgtgttagcgatcttccagatgcagagcttgatccagctgtgaag
gaagcctttgatgttgcatatgacaatatatatgccttccatgtttcacaaaaaatacct
gagaagacagttgaaaatatgaaaggcgtaagatgtaagagaataactagatgcattggt
tctgttgggctgtatgtcccaggtggcactgcagtcttgccttcaactgcattgatgctt
gctgtgcctgcacagattgctggatgcaaaactattgttcttgccacaccacctagccgt
gatggtagcatatgcaaggaggttctttactgtgcaaagaaagctggtgtgacacacata
ttgaaagctggaggagctcaggcaatctcagcaatggcatggggaactgcatcttgccca
aaggctgagaagatttttggacctggtaaccagtatgtaacagctgccaaaatgattctt
cagaacagtgaagctatggtatctatagacatgcctgctggcccttctgaagttttagtc
attgctgataaatacgcgaacccagttcatgttgctgctgatctgctatcccaggcagaa
catggcccagatagtcaggttgttctagttgttgctggagatggtgttgatctgggtgcc
attgaggcagaagttagcaagcagtgcaacgcgcttccaagaggtgaattcgcttcaaaa
gcacttagccacagcttcactgtgttcgcgaaagatatggttgaggcgatatcattctca
aatctgtatgcccctgagcatttgatcatcaacgtaaaggatgctgagcagtgggaggag
ttcatcgaaaacgcagggtcagttttcttgggccaatggaccccagagagcgtgggcgat
tatgcgagcgggacgaaccatgtccttccgacctatggttacgcaaggatgtacagcggt
gtatcgctgaactctttcctcaaatacatcactgtccaatccctaacagaggaagggctg
agaaagctggggccgtacgtcgcgaagatggccgaagtggaggggctagaggcgcacaag
agagccgttacccttaggctgcaagaggttgaggccaatgtaactgtctag

DBGET integrated database retrieval system