KEGG   Zea mays (maize): 100304425Help
Entry
100304425         CDS       T01088                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 694 aa AA seqDB search
MAALEAVRSWAVSVIPPELAAAAGGDPLAALAATAAALVAGLLILAVWFRSGGGAPSKPV
ATPLRPPPVKVDADADVDDGRKRVTIFFGTQTGTAEGFAKSMADEARVRYEKAVFKVVDL
DDYAQEDEEYEEKLKKETVALFFLATYGDGEPTDNAARFYKWFTEGKEKEVWLKDLKYGI
FGLGNRQYEHFNKVAKVVDELLEEQGGKRLVPVGLGDDDQCIEDDFTAWKELVWPELDQL
LRDEDDTNGASTPYTAAIPEYRVVFIDKSDLSFQDRSWSLANGTGVIDIHHPCRANVAVR
KELHKPASDRSCIHLEFDISGTSLVYETGDHVGVYAENSVETVEEAESLLDLSPDTVFSI
HADAEDGSPRKGGSSLAPPFPSPCTLRTALLRYADLLNPPKKAALLALASHASDPAEAER
LRFLASPAGKDEYSQWITASQRSLLEVMAAFPSAKPPLGVFFAAIAPRLQPRYYSISSSP
KMAPSRIHVTCALVYGPSPTGRIHQGVCSTWMKNTIPLEYSEECSWAPIFVRQSNFKLPA
DPSTPIIMIGPGTGLAPFRGFLQERLALKQSGAELGTSILFFGCRNRNMDYIYEDELQTF
LEEGALSELIVAFSREGPTKEYVQHKMVEKATEIWNIISHGGYLYVCGDAKGMARDVHRM
LHTVVQEQGSLDSSKTESYVKSLQMEGRYLRDVW
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggcggcactggaggcggtgaggtcgtgggcggtgtccgtcatcccgccggagctcgcc
gccgccgcggggggagacccgctcgccgcgctggcagccaccgccgcggcccttgtcgcg
gggctgcttatcctcgccgtctggttccgatccggaggcggggcgccgtccaagccggtc
gccacgccattacggccgccgccggtgaaggtggacgccgacgccgacgtggacgacggg
cggaagcgcgtcaccatcttcttcggcacgcagaccggcaccgccgagggattcgccaag
tcgatggcggacgaggcgagggtgcggtacgagaaggccgtgtttaaagtggtggatctg
gatgactatgctcaggaggacgaggaatacgaggagaagctgaagaaggaaactgtggcg
ctgttcttcttagcaacatatggggatggagagccaactgataacgcagcaagattctac
aaatggtttactgagggaaaagagaaggaagtttggctgaaggatcttaaatatggtatt
tttggccttggaaacaggcagtatgaacattttaataaggttgcaaaggtggtagatgag
ctactagaggagcagggtgggaaacgtcttgttcctgttggccttggagatgatgatcag
tgcattgaggatgatttcactgcatggaaagaactagtgtggccagagttggatcaattg
ctccgcgacgaggatgacacaaatggtgcatcaactccatatactgctgctattcctgaa
tacagagttgttttcattgataaatctgacctgtcattccaagatagatcatggtcacta
gccaacggtactggtgtgattgatattcaccacccttgcagggctaatgttgctgttcga
aaggagctgcacaaaccagcttcagaccgctcttgtattcatcttgagtttgatatttct
ggcactagtcttgtgtatgaaaccggagaccatgttggtgtatatgcagaaaattctgtt
gagactgtggaggaggctgaaagcctacttgacctttctccagatacagtcttctccatc
catgcagatgcagaagatgggtctcctcgtaaaggaggaagttccttggccccacctttc
ccatctccatgtactttgcggactgcgcttctacgatatgctgatctactcaatccaccg
aagaaggctgctttgcttgctttagcttctcatgcatctgatccagctgaagctgaacga
cttaggttcttggcctctcctgctggaaaggatgagtattctcaatggataactgctagt
cagaggagtcttcttgaagttatggctgcattcccttcagctaagccaccactgggagtg
tttttcgcagcaatagctcctcgtctgcaaccacgatactactcaatttcatcatctcca
aagatggctccctccagaattcatgtaacatgtgcattagtttatgggccttcaccaaca
ggaaggatccaccaaggagtttgttcaacatggatgaagaatacaattcctctggaatat
agcgaagaatgcagctgggctcccatatttgtgaggcagtcaaatttcaagttacctgct
gacccatccactccgattatcatgattggtcctgggacagggctggctccttttagaggt
ttcttgcaggaaaggttagcactgaaacaatctggagcagaactgggcacttcaatcctt
ttctttggatgcaggaaccgtaatatggactacatatatgaagatgagctgcaaactttc
cttgaggagggggcgctttctgagctaattgttgcattctctcgggaagggccaactaaa
gaatatgtgcagcataagatggtggagaaggccacagaaatttggaacatcatctcacat
ggtggttacttatatgtatgcggtgatgccaagggaatggctagagacgtacacaggatg
cttcatacagtagtccaagagcagggatctttggatagctccaaaaccgagagctacgta
aagagcctgcagatggaaggcaggtacctccgtgatgtatggtga

DBGET integrated database retrieval system