KEGG   Zea mays (maize): 100381286Help
Entry
100381286         CDS       T01088                                 

Definition
eukaryotic translation initiation factor 4E-1(eIF4E-1)(mRNA cap-binding protein)
Orthology
K03259  
translation initiation factor 4E
Organism
zma  Zea mays (maize)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100381286
Messenger RNA biogenesis [BR:zma03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100381286
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100381286
Translation factors [BR:zma03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100381286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 218 aa AA seqDB search
MAEETDTRPASAGSRGRPAPEDDDREEGEITDLACAPSPPATHPLEHSWTFWFDNPQSKS
KQAAWGSSIRPIHTFSTVEEFWGLYNNINHPSKLIVGADFHCFKNKIEPKWEDPICANGG
KWTISCGRGKSDTFWLHTLLAMIGEQFDYGDEICGAVVSVRGKQERIAIWTKNAANEAAQ
VSIGKQWKELLDYKDSIGFIVHDDAKKMDKGLKNRYTV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggagaccgacaccaggcctgcctccgcgggctcccgaggccgccccgcgccc
gaggacgacgacagggaggagggcgagatcaccgacctcgcctgcgctccttccccgccc
gccacgcacccgctcgagcactcctggaccttctggttcgacaacccgcagagcaagtcc
aagcaggccgcctgggggagctccatccgccccatacacaccttctccaccgtcgaggaa
ttctgggggctttacaataacattaatcaccctagcaaattgatcgtgggagctgatttc
cattgcttcaagaacaagatcgagccaaaatgggaagaccctatttgtgcgaatggtggt
aaatggaccatcagctgtggaagaggaaaatctgatacattttggctgcacactctgctg
gctatgattggtgaacaattcgactatggtgatgaaatttgtggcgcagttgtcagtgtg
cgtgggaagcaggaaagaattgctatttggacaaaaaatgctgccaatgaagccgctcag
gtaagcatcgggaagcagtggaaggaacttctggactacaaggactccattggattcatt
gttcatgacgatgcaaagaagatggacaaaggcctgaagaaccgttacacggtttga

DBGET integrated database retrieval system