KEGG   Zea mays (maize): 100381286Help
Entry
100381286         CDS       T01088                                 

Definition
eukaryotic translation initiation factor 4E-1(eIF4E-1)(mRNA cap-binding protein)
Orthology
K03259  
translation initiation factor 4E
Organism
zma  Zea mays (maize)
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:zma03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 218 aa AA seqDB search
MAEETDTRPASAGSRGRPAPEDDDREEGEITDLACAPSPPATHPLEHSWTFWFDNPQSKS
KQAAWGSSIRPIHTFSTVEEFWGLYNNINHPSKLIVGADFHCFKNKIEPKWEDPICANGG
KWTISCGRGKSDTFWLHTLLAMIGEQFDYGDEICGAVVSVRGKQERIAIWTKNAANEAAQ
VSIGKQWKELLDYKDSIGFIVHDDAKKMDKGLKNRYTV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggagaccgacaccaggcctgcctccgcgggctcccgaggccgccccgcgccc
gaggacgacgacagggaggagggcgagatcaccgacctcgcctgcgctccttccccgccc
gccacgcacccgctcgagcactcctggaccttctggttcgacaacccgcagagcaagtcc
aagcaggccgcctgggggagctccatccgccccatacacaccttctccaccgtcgaggaa
ttctgggggctttacaataacattaatcaccctagcaaattgatcgtgggagctgatttc
cattgcttcaagaacaagatcgagccaaaatgggaagaccctatttgtgcgaatggtggt
aaatggaccatcagctgtggaagaggaaaatctgatacattttggctgcacactctgctg
gctatgattggtgaacaattcgactatggtgatgaaatttgtggcgcagttgtcagtgtg
cgtgggaagcaggaaagaattgctatttggacaaaaaatgctgccaatgaagccgctcag
gtaagcatcgggaagcagtggaaggaacttctggactacaaggactccattggattcatt
gttcatgacgatgcaaagaagatggacaaaggcctgaagaaccgttacacggtttga

DBGET integrated database retrieval system