KEGG   Zea mays (maize): 100381337Help
Entry
100381337         CDS       T01088                                 

Definition
MPK14 - putative MAPK
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 370 aa AA seqDB search
MAMMVDPPNGIGNQGKHYYSMWQTLFEIDTKYVPIKPIGRGAYGIVCSSINRETNEKVAI
KKIHNVFDNRVDALRTLRELKLLRHLRHENVIALKDIMMPIHRRSFKDVYLVYELMDTDL
HQIIKSPQGLSNDHCQYFLFQLLRGLKYLHSAEILHRDLKPGNLLVNANCDLKICDFGLA
RTNSSKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIVNVLGTMSEADLEFIDNPKARRYIKSLPYTPGVPLVSMYPHAHPLAIDLLQKML
IFDPTKRISVTEALEHPYMSPLYDPSANPPAQVPIDLDIDENISSEMIREMMWQEMLHYH
PEVATAISMS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgatggtggatcctccaaatggaatcgggaaccaaggaaagcattactactct
atgtggcagaccttatttgagatagacaccaaatatgtgccgatcaagcccattggtcga
ggagcttatgggatagtttgttcatccattaatcgtgaaacaaatgagaaagtagcaata
aagaagatacacaacgttttcgacaaccgtgtggatgcactacggaccttgcgggagctg
aaactccttcgccatctccggcatgagaatgtcattgctttgaaggatataatgatgcca
atacacaggagaagctttaaggatgtgtacttggtatacgaactcatggatactgatttg
caccagataatcaaatcacctcagggcctttccaatgaccactgccagtattttcttttt
cagttgctccgaggactcaaatatctccattcagcagaaatactccacagagacctaaaa
cctggaaacctgctggtgaatgcaaattgtgatctgaagatatgtgattttggtctcgca
cgtacaaacagtagcaaaggccagttcatgactgaatacgtcgtcacccgctggtacaga
gctcctgagctgctcctctgctgcgacaactacggcacatccatagacgtctggtctgtt
gggtgcatctttgctgagctccttggccgcaagccaatatttccaggaactgaatgcctg
aatcaactcaagctcatagtgaacgtcctcggcaccatgagtgaggctgacctagagttc
atcgacaacccaaaggctcggagatacatcaagtcccttccctatacccctggtgttcct
ctcgtaagtatgtacccacatgcgcaccctcttgccattgatctgttgcagaagatgctc
atcttcgaccccaccaaaaggatcagtgtcaccgaagctctcgagcacccttacatgtcc
cctctgtatgatccaagcgcaaatcccccagcccaagtgcccatcgatctggacatagac
gaaaacatcagctcagagatgatccgggaaatgatgtggcaggagatgcttcactaccac
cctgaagttgccacagcaataagcatgtcatga

DBGET integrated database retrieval system