KEGG   Zea mays (maize): 100381522Help
Entry
100381522         CDS       T01088                                 

Gene name
pco094517
Definition
LOC100381522
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
zma  Zea mays (maize)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:zma00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 588 aa AA seqDB search
MVLARVLPLPAPSSAPHRRLLLPTQAAPAPARVLTVRAVACRAANAMAAVALDPPAVAPS
PAEVAAVGVGEELPEGYDQMMPTVEPSRRRRAGLLLHPTSLRGPHGIGDLGDEALAFLHW
LRDAGCTLWQVLPLVPPGRTAGEDGSPYSGQDANCGNTLLLSLEELVKDGLLMSDELPDP
VDTEYVEFDTVANLKEPLIAKAAERLLLSHGELRTQYDCFKKNPNISGWLEDAALFAAID
KSINAFSWYEWPEPLKNRHLGALEDIYEKQKDFIETFMAQQFLFQRQWQRIRKYAQKLGI
SIMGDMPIYVGYHSADVWANRKSFLLDKNGFPTFVSGVPPDAFSETGQLWNSPLYDWKAM
EADCFSWWIKRIKRALDLYDEFRIDHFRGLAGFWAVPSDAKVALVGSWRAGPRNSFFDTL
FKAVGRIDIIAEDLGVITEDVVQLRKSIGAPGMAVLQFAFGGGSDNPHLPHNHEMDQVVY
TGTHDNDTVLGWWQNLPEEEKKIVIKYLPEAENIDITWTLITAALSSVARTSVVTMQDIL
GLDSSARMNTPATQKGNWRWRIPSSVGFDSLSPEAAKLKELLALYNRQ
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggttctcgcgcgagtcctcccgctgcccgccccgtcgtccgcgccccaccgccgctta
ctcctgccgactcaggcggcgccggccccggcgcgtgtgctcaccgtgcgggccgtcgcc
tgccgcgcagcgaacgccatggcggccgttgctctggacccgcccgcggtcgctccgagc
cccgcagaggtcgcagccgtgggcgtcggggaggagctgccggaagggtacgatcagatg
atgccgaccgtggagccgtcgcggaggcggcgcgccgggctgctgctgcatcctacttcg
ttgcggggcccgcacggcatcggcgacctcggggacgaggcgcttgctttcctgcattgg
ctccgcgacgccggctgcacgctctggcaggttctaccacttgttcctccaggtaggacg
gctggggaggatgggtctccttattctggacaggatgccaactgtggcaatacccttttg
ctatcccttgaggagcttgtaaaagatggtctactgatgtcagatgaacttcctgatcct
gtggatacagagtatgttgaatttgacactgttgcaaatctgaaagaaccacttattgca
aaggcagcagagaggctcctactaagccatggagagctcagaacacaatatgactgcttc
aaaaaaaatccaaatatatcaggttggcttgaagatgcagctctttttgctgctattgac
aaaagcatcaatgcattctcttggtacgagtggcctgaacctctgaaaaatcgccatctt
ggagccttggaagatatatatgaaaaacagaaggattttatagagacatttatggctcag
cagttcttatttcaaaggcaatggcagcggattcgtaaatatgcacaaaagctgggtatc
agcatcatgggtgacatgcctatatatgttggctaccatagcgcagatgtttgggcgaac
aggaaatcatttttgctggacaaaaacggtttccccactttcgttagtggcgttccacct
gatgcatttagtgaaacgggtcaactatggaacagtccattgtacgactggaaagctatg
gaagcagattgtttttcatggtggataaagaggattaaacgtgcccttgatttgtatgat
gaattccgtattgaccatttccgggggcttgcgggtttttgggcagtcccttctgatgca
aaagtagcactggttggaagctggagggctggaccaaggaatagcttttttgacacgctc
ttcaaagctgttggtagaatagatataatagcagaagatctgggggtaattactgaagat
gtcgttcagctaaggaaatccattggggcccctgggatggcagttctccagtttgctttc
ggaggtggttctgacaaccctcatttgccacacaaccatgaaatggatcaagttgtgtac
actggaacacatgataacgatacagttcttggctggtggcaaaatttaccagaggaagaa
aagaaaattgtgatcaagtatctaccagaagccgagaatattgacataacatggacactg
attacggctgccctctcttccgtcgcgaggacttccgtggtaaccatgcaggacattctt
ggccttgacagttctgctagaatgaatactccagctacccagaaaggaaactggaggtgg
aggataccgagctctgttggcttcgacagcctcagccctgaagcagcaaagctgaaggag
ctgcttgcgctgtacaatcgacagtga

DBGET integrated database retrieval system