KEGG   Zea mays (maize): 100381522Help
Entry
100381522         CDS       T01088                                 

Gene name
pco094517
Definition
LOC100381522
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
zma  Zea mays (maize)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100381522 (pco094517)
Enzymes [BR:zma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     100381522 (pco094517)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 588 aa AA seqDB search
MVLARVLPLPAPSSAPHRRLLLPTQAAPAPARVLTVRAVACRAANAMAAVALDPPAVAPS
PAEVAAVGVGEELPEGYDQMMPTVEPSRRRRAGLLLHPTSLRGPHGIGDLGDEALAFLHW
LRDAGCTLWQVLPLVPPGRTAGEDGSPYSGQDANCGNTLLLSLEELVKDGLLMSDELPDP
VDTEYVEFDTVANLKEPLIAKAAERLLLSHGELRTQYDCFKKNPNISGWLEDAALFAAID
KSINAFSWYEWPEPLKNRHLGALEDIYEKQKDFIETFMAQQFLFQRQWQRIRKYAQKLGI
SIMGDMPIYVGYHSADVWANRKSFLLDKNGFPTFVSGVPPDAFSETGQLWNSPLYDWKAM
EADCFSWWIKRIKRALDLYDEFRIDHFRGLAGFWAVPSDAKVALVGSWRAGPRNSFFDTL
FKAVGRIDIIAEDLGVITEDVVQLRKSIGAPGMAVLQFAFGGGSDNPHLPHNHEMDQVVY
TGTHDNDTVLGWWQNLPEEEKKIVIKYLPEAENIDITWTLITAALSSVARTSVVTMQDIL
GLDSSARMNTPATQKGNWRWRIPSSVGFDSLSPEAAKLKELLALYNRQ
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggttctcgcgcgagtcctcccgctgcccgccccgtcgtccgcgccccaccgccgctta
ctcctgccgactcaggcggcgccggccccggcgcgtgtgctcaccgtgcgggccgtcgcc
tgccgcgcagcgaacgccatggcggccgttgctctggacccgcccgcggtcgctccgagc
cccgcagaggtcgcagccgtgggcgtcggggaggagctgccggaagggtacgatcagatg
atgccgaccgtggagccgtcgcggaggcggcgcgccgggctgctgctgcatcctacttcg
ttgcggggcccgcacggcatcggcgacctcggggacgaggcgcttgctttcctgcattgg
ctccgcgacgccggctgcacgctctggcaggttctaccacttgttcctccaggtaggacg
gctggggaggatgggtctccttattctggacaggatgccaactgtggcaatacccttttg
ctatcccttgaggagcttgtaaaagatggtctactgatgtcagatgaacttcctgatcct
gtggatacagagtatgttgaatttgacactgttgcaaatctgaaagaaccacttattgca
aaggcagcagagaggctcctactaagccatggagagctcagaacacaatatgactgcttc
aaaaaaaatccaaatatatcaggttggcttgaagatgcagctctttttgctgctattgac
aaaagcatcaatgcattctcttggtacgagtggcctgaacctctgaaaaatcgccatctt
ggagccttggaagatatatatgaaaaacagaaggattttatagagacatttatggctcag
cagttcttatttcaaaggcaatggcagcggattcgtaaatatgcacaaaagctgggtatc
agcatcatgggtgacatgcctatatatgttggctaccatagcgcagatgtttgggcgaac
aggaaatcatttttgctggacaaaaacggtttccccactttcgttagtggcgttccacct
gatgcatttagtgaaacgggtcaactatggaacagtccattgtacgactggaaagctatg
gaagcagattgtttttcatggtggataaagaggattaaacgtgcccttgatttgtatgat
gaattccgtattgaccatttccgggggcttgcgggtttttgggcagtcccttctgatgca
aaagtagcactggttggaagctggagggctggaccaaggaatagcttttttgacacgctc
ttcaaagctgttggtagaatagatataatagcagaagatctgggggtaattactgaagat
gtcgttcagctaaggaaatccattggggcccctgggatggcagttctccagtttgctttc
ggaggtggttctgacaaccctcatttgccacacaaccatgaaatggatcaagttgtgtac
actggaacacatgataacgatacagttcttggctggtggcaaaatttaccagaggaagaa
aagaaaattgtgatcaagtatctaccagaagccgagaatattgacataacatggacactg
attacggctgccctctcttccgtcgcgaggacttccgtggtaaccatgcaggacattctt
ggccttgacagttctgctagaatgaatactccagctacccagaaaggaaactggaggtgg
aggataccgagctctgttggcttcgacagcctcagccctgaagcagcaaagctgaaggag
ctgcttgcgctgtacaatcgacagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system