KEGG   Zea mays (maize): 100382000Help
Entry
100382000         CDS       T01088                                 

Gene name
pco127746
Definition
LOC100382000
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 322 aa AA seqDB search
MWALLVNCGENLYYLCRHYLQSECLEHIFVLSTFLRPVYGLIFLFKWIPGEKDERPVVRD
PNPNLFFAHQVITNACATQAILSVLMNRPEIDIGPELSQLKEFTGAFTPDLKGLAISNSE
SIRTAHNSFARPEPFISDEQRAATKDDDVYHFISYLPFEGVLYELDGLKEGPVNLGQCDG
ADDLDWLRMVQPVIQERIERYSQSEIRFNLMAIIKNRKEVYSAELEELEKRREQILQEMN
NASSTESLSSSLTEVISAIETVTEKVIMEEEKFKKWKKENIRRKHNYIPFLFNLLKMLAE
KQQLKPLVEKAKQQKSASPSTS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtgggctctcttagtcaactgcggtgagaatctttattatttatgtcgtcattatctg
caatctgaatgccttgaacacatatttgtcctctccacttttcttaggccagtatatggg
ctaatttttctcttcaagtggatacccggggagaaggatgaacggcctgttgtcagagat
cctaacccaaaccttttctttgcgcaccaagtcatcactaatgcatgtgctactcaagct
attctctcagttctcatgaatcgccctgaaattgacattggcccagaattatctcaattg
aaggaattcacaggagcttttacaccagatctgaagggcttggctattagcaacagcgaa
tctatccggacagctcataacagctttgcaaggccagagccatttatttctgatgagcag
agggccgcaactaaggatgatgatgtttaccatttcataagctatttaccttttgaaggt
gtcctgtatgagctggatggactgaaggaagggcctgtgaatcttgggcagtgcgatggt
gctgatgatcttgattggctacggatggtgcagccagttattcaagaaaggattgagcgc
tactcacaaagcgagatcaggttcaatctcatggccatcataaagaacaggaaagaggtg
tacagtgctgagcttgaggaactggagaagagaagggagcagattttgcaggagatgaat
aatgcttcctccacagaatccttgagcagttcgcttacggaggtgatatcggcaatcgaa
actgtcacggagaaggtcatcatggaagaagagaagttcaagaagtggaagaaggagaac
attcggaggaaacataactacatccctttcttgttcaacttgctgaagatgcttgcagag
aagcagcagctaaaacctctggtcgagaaggccaaacagcaaaagtcagcaagcccgagc
acgagttga

DBGET integrated database retrieval system