KEGG   Zea mays (maize): 100382191Help
Entry
100382191         CDS       T01088                                 

Definition
uncharacterized LOC100382191
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
zma  Zea mays (maize)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100382191
Enzymes [BR:zma01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     100382191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 581 aa AA seqDB search
MEIESRLLPCGLHVIGEPPSAIEAVATLVNIAALDRPEDGITSLPGILAATVGRDIEDVY
RGSDKGILADVELLRQITEASRGAITAFVEKTTNSKGQVVNVANNLSKILGFGLSEPWVQ
YLSATKFVRADREKMRVLFGFLGECLRLVVQDNELGSLKLALEGSYVEPGPGGDPIRNPK
VLPTGKNIHALDPQAIPTTAALKSAKIVVDRLLERQKADNGGKYPETVALVLWGTDNIKT
YGESLAQVLWMIGVRPVADTFGRVNRVEPVSLEELGRPRIDVVVNCSGVFRDLFINQMNL
LDRAVKMVAELDEPAEMNYVRKHAQEQAEELGVSLREAATRVFSNASGSYSSNVNLAVEN
ASWTDEKQLQDMYLSRKSFAFDSDAPGAGMKEKRKAFELALATADATFQNLDSSEISLTD
VSHYFDSDPTKLVQGLRKDGRAPSSYIADTTTANAQVRTLSETVRLDARTKLLNPKWYEG
MMKSGYEGVREIEKRLTNTVGWSATSGQVDNWVYEEANSTFIEDEAMRKRLMDTNPNSFR
KLVQTFLEASGRGYWETTEENLDRLRELYSEVEDKIEGIDR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggagatagagtcacggctccttccctgcggtctgcatgtcatcggcgagccgccgagt
gccatcgaggcggtggccacgctggtgaacatagctgccctcgaccgccccgaggacggc
ataacctcgctgcccggcatacttgccgccacagtgggcagggacattgaagatgtgtac
aggggaagtgacaagggcatactggctgacgtcgagcttctgaggcagatcactgaggct
tcgcgcggcgccatcaccgccttcgttgagaagaccacaaacagcaaagggcaagtcgtc
aatgttgccaacaacctcagcaagatacttggtttcggcctgtcggaaccatgggtgcag
tacctgtccgcgaccaagttcgtcagagcggacagagagaagatgagggttctgtttggg
ttcttgggggagtgcctgaggctcgtcgtgcaagacaacgagctgggaagcttgaagctt
gccctcgagggaagctacgtcgagcctggacctggcggcgacccgatccgtaacccgaag
gtgctcccgacagggaagaacatccacgctctcgatccgcaggccatcccaaccacggct
gccttgaagagcgccaagatcgtcgtggaccgtctcctggagaggcagaaggctgacaat
ggcggcaagtaccctgagacggtcgcacttgtcctgtggggcaccgataacatcaagacc
tatggtgagtcactagcccaggtgctgtggatgattggagttcggccagttgccgacacc
ttcggccgtgtcaaccgtgtggagcctgtcagccttgaggagcttggacgcccgaggatc
gatgtcgtcgtcaattgctcgggtgttttcagagatcttttcatcaaccagatgaacctg
ctggacagggcagtgaagatggtggccgaactggacgagccagcagagatgaactacgtg
cgcaagcacgcccaggagcaggcggaggagctcggcgtgtcgctaagggaggcggcgaca
agggtgttctcgaacgcatcaggctcctactcgtccaacgtgaacctggcggtggagaac
gcgtcatggaccgacgagaagcagctccaggacatgtacctgagccgcaagtccttcgcg
ttcgacagcgacgcccctggggcaggcatgaaggagaagcgcaaggcgttcgagctcgcc
ctggcgacggcggacgccacgttccagaacctcgactcgtcggagatctcgctgacggac
gtgagccactacttcgactcggacccgaccaagctcgtgcaggggctgcgcaaggacggg
cgggcgccgtcctcgtacatagccgacaccaccacggcgaacgcccaggtgaggacgctg
tcggagacggtgcgcctcgacgcgaggaccaagctgctgaaccccaagtggtacgagggg
atgatgaagagcgggtacgagggggtcagggagatcgagaagcggctcaccaacaccgtc
gggtggagcgccacgtctgggcaggtcgacaactgggtctacgaggaggccaactccacg
ttcatcgaggacgaggcgatgaggaagaggctcatggacaccaaccccaattcgttcagg
aagttggtgcagaccttcctggaagccagtggcagaggctactgggagacaacggaggag
aacctggacaggctcagggagctctattcggaggttgaagacaagattgaggggattgac
aggtaa

DBGET integrated database retrieval system