KEGG   Zea mays (maize): 100382570Help
Entry
100382570         CDS       T01088                                 

Definition
uncharacterized LOC100382570
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100382570
Protein kinases [BR:zma01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100382570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 321 aa AA seqDB search
MEEPGREGDSPGPPWAPSESSAFRAFVTAVGERAVASPSGSDNGDSVCSSNLRAVRKRPF
VARLTTYIIQTFEKCNPEFKYSESLNPKRFLTNPAVPVHNHGLDNANSDLILYVNLELLN
KKSSRRYVVQEMLGQGTFGQVAKCWDAETNSYVAVKVIKNQPAFYQQAIMEVSLLRLLNE
KFDPDDEHHIVRMLDFFLYQNHLCIAFEMLGNNLYELLKRNSLRGLQMKYVRTFSRQILD
ALIIMKDAGIIHCDLKPENILIAPTVKTAVGVKVIDFGSVCMEGKTIYSYIQSRYYRSPE
VLLGYPYAKSRMGLRKRDKHP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacctgggagggagggggattcccccgggccgccgtgggcgccaagtgagtcc
tcagctttccgggcgttcgttacggcggtgggggagcgggcggtggcgtcgccttcaggc
tcggacaatggggattccgtctgctcaagcaacctccgcgccgtcaggaagagacctttt
gttgcaagattaaccacatatatcatccaaacttttgaaaaatgcaatcctgagtttaag
tactcagagtcactaaaccccaagcgctttctcaccaatcccgcagttcctgttcacaac
catggtcttgacaatgcaaactctgatctcatattgtatgtcaacctggaactgcttaat
aaaaagtcaagccggaggtatgttgtccaagaaatgcttggccaaggtacctttggacag
gttgcgaaatgctgggatgcagaaactaacagttatgttgcagtgaaggttataaagaat
cagcctgccttttaccagcaggctatcatggaggtctctttattaagattgttaaatgag
aaatttgatcctgatgatgaacatcacattgtccggatgctggattttttcctctaccaa
aaccatttgtgtatagcctttgaaatgcttggtaacaacctgtatgagctgttgaaaagg
aatagtttaagaggtttgcaaatgaaatatgttcgaactttctcaagacagatactggat
gccctgattatcatgaaagatgctggcattattcattgtgatctaaaaccagaaaacatc
cttatagctccaactgtaaaaacagcagttggagtgaaagtaattgattttggatcagtg
tgcatggagggtaaaaccatttattcatatattcagagccgttattacaggtctccagaa
gtacttcttggttatccatatgcaaaatcacggatgggccttcggaagcgtgataagcac
ccctaa

DBGET integrated database retrieval system