KEGG   Zea mays (maize): 100382642Help
Entry
100382642         CDS       T01088                                 

Definition
uncharacterized LOC100382642
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 686 aa AA seqDB search
MSNSLAPLDPITNGSADRNKKVAYFYDSDVGNYAYVSGHPMKPHRIRMAHSLVMNYGLYK
KMEIYRAKPASKYEMTQFHTDEYIDFLSKVTPDNMDSFAKEQSKYNVGDDCPVFDGLFEF
CGISAGGSMEGAARLNRNKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRFKQR
VLYVDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGQGKHYAVNFPLR
DGIDDISYKSIFEPVIKSVMEWYRPEAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNFVK
SFNLPTMILGGGGYTMRNVARTWAFETGILVGDTLGAELPYNDYYEYFAPDYELDVRPSN
MDNANTKEYLDKIRTQVVENLKRTAFAPSVQMTEVPREPLVEGMDDEADAILDDLDEDEN
KDKRFTKRRFDQYIEKPGELSDSDDEELAGANGVRRQPNALKRRNQVNYRNLDVNDSGLE
SGMATPQDASSIPDDDMDTTGDAKMTEAPEPETEAQATPSAADAPSRADEASATEQTEMA
VDGPETTAASAPISRQPSPKPQDEDTAMVDAGEAAPETEKSEAAPEGAAEEEETKPSEET
PAADKPATEETPAAKEESPAKETTEAADTAEAETKPAEASEPSETKDKTPEAAKDESGEA
KSKEPSAEAAGATEAEKTEEGSKTEE
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactcactcgcgcctttggatcccattaccaatgggtcggcggatcgcaataag
aaagtcgcctatttctacgattccgacgtgggaaactatgcctatgtttcgggacacccg
atgaagcctcatcgcataaggatggctcacagtttggtcatgaactatggcctttataag
aagatggagatataccgggcgaagccggcctcgaaatatgaaatgacccagttccacacg
gatgagtatatcgacttcctttcgaaggttacaccggacaatatggactccttcgcgaag
gagcagagcaagtacaatgtcggagacgattgtcccgttttcgatgggctcttcgagttt
tgcggtatcagcgcgggtggtagtatggagggtgccgctcggctcaaccgcaacaagtgt
gacattgccgttaactgggccggtggtcttcaccacgcgaagaaaagtgaagcaagtgga
ttctgttatgtaaatgacatcgttctgggtatcctggagctgctgcgattcaagcaacgc
gtgctctacgttgatatcgatgtccaccacggagatggtgttgaggaggcattctacacg
actgaccgtgtgatgacggtgtccttccacaagtacggcgagtacttcccaggtacgggt
gagctgcgcgatatcggagtgggtcagggcaagcactatgccgtcaacttccctctccgc
gatggcattgatgacatctcctacaagagtatttttgagcccgttatcaagagcgttatg
gaatggtaccgacccgaagcggtggtcttgcagtgtggtggcgacagtctttcgggcgac
cgtctcggatgcttcaacctcagtatgcggggccacgcgaattgtgtgaactttgtgaag
agctttaacctgcccaccatgattctcggcggtggtggttatacgatgcgaaatgtggca
cgtacttgggccttcgaaaccggtattctcgttggtgacacccttggggcagagcttcct
tacaacgattactacgagtacttcgcacctgactacgagctggatgtacgtccgtccaac
atggacaatgccaacacgaaggagtacctggacaagatccgcacacaggtcgtggagaac
ctcaagcggaccgcctttgcgccctccgtgcagatgaccgaggtgccacgagagcctctc
gtggagggcatggacgacgaggcagatgccatcttggacgatctggacgaggacgagaac
aaggacaagcgcttcaccaagcggcgcttcgatcagtacattgagaagcccggagagctt
agcgacagtgacgacgaggagctggctggggccaacggtgtccggcggcaacccaacgcg
cttaagcggagaaaccaggtcaactatcggaatctcgatgtgaacgattcggggctggag
agcggcatggctacgccacaggacgcatcctccatccctgacgatgacatggatacgact
ggtgatgcgaagatgaccgaggctccggagccggagactgaggcgcaagccaccccctct
gcggccgatgcgccgtcccgagcagatgaagcctccgcgacagagcagacagagatggca
gtggatggaccagaaacgacggcagcatcggcgccgatctcccggcaaccgtctcccaag
ccccaggacgaagacaccgcgatggtagatgcgggcgaggccgcaccggaaaccgagaaa
tccgaagctgcgcctgaaggcgcggctgaagaagaagagacgaagcccagcgaggagacc
cctgcggctgacaagcccgctacggaagagacgcctgccgcaaaagaagagtcacctgcg
aaagagacaactgaggcagccgatacggcagaagcggagaccaagcctgcggaggccagt
gagccgagtgagaccaaggacaagacaccagaggcagccaaggacgagtcgggtgaggct
aaatcaaaggagcccagcgcggaagccgcaggagcaacagaagccgagaagaccgaggaa
ggaagcaagactgaggagtga

DBGET integrated database retrieval system