KEGG   Zea mays (maize): 100382676Help
Entry
100382676         CDS       T01088                                 

Definition
uncharacterized LOC100382676
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100382676
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100382676
   00051 Fructose and mannose metabolism
    100382676
   00052 Galactose metabolism
    100382676
   00500 Starch and sucrose metabolism
    100382676
   00520 Amino sugar and nucleotide sugar metabolism
    100382676
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    100382676
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100382676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 490 aa AA seqDB search
MVGIGPKRPPSRKGSMADVPQNLLQQIKDFEEQFTVDRSKLKQIVNHFVKELEKGLSVEG
GNIPMNVTWVMGFPDGDEQGTFLALDMGGTNLRVCEITLTQEKGAFDITQSKYRMPEELK
TGTAEELWEYIADCLQQFIEAHHENEKISKLPLGFTFSYPATQDYIDHGVLQRWTKGFDI
DGVEGHDVVPPLEAILQKRGLPIKVAALINDTTGTLIASAYTDTDMKIGCIFGTGVNAAY
MENVGSIPKLAHMNLPADMPVAINCEYGAFDNEHVVLPLTKYDHIIDRDSPRPGQQAFEK
MTAGLYLGEIFRLALMDLVENRPGLIFNGQDTTKLRKPYILDSSFLAAIEEDPYENLEET
EELMERELNIKATPAELEMIRRLAELIGTRAARLSACGVAAICTKKKIDSCHVGADGSVF
TKYPHFKARGAKALREILDWAPEEKDKVTIMAAEDGSGVGAALIAALTLKRVKAGNLCGI
RNMADMKTLL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggttggaatcggtcctaagcgtcccccttcccgcaagggttctatggccgatgttccc
cagaaccttttgcagcagatcaaggatttcgaggagcaattcaccgttgatcgctccaag
ctcaagcagattgtcaaccactttgttaaggaattggaaaagggtctcagtgtcgagggc
ggaaacatccctatgaacgtcacctgggtgatgggattccccgatggcgacgaacagggt
actttcctcgccctcgacatgggtggcaccaacctgcgtgtctgtgagatcaccctgacc
caggagaagggtgctttcgacatcacccaatccaagtaccgcatgcccgaggaattgaag
accggtactgccgaggagctgtgggaatacatcgccgactgcctgcagcagttcatcgag
gctcaccacgagaacgagaagatctccaagctgcccctgggtttcaccttctcctacccc
gccacccaggactacatcgaccacggtgtcctgcagcgctggaccaagggtttcgacatt
gatggtgtcgagggccacgacgtcgtccctccgttggaggccatcctgcagaagcgcggc
ctgcccatcaaggtggctgctctgatcaacgacaccaccggaaccctcatcgcctctgct
tacaccgacaccgacatgaagatcggctgcatcttcggtaccggtgtcaacgccgcctac
atggagaatgttggctccatccctaagctggcccacatgaacctgcccgccgacatgccc
gtggctatcaactgcgagtatggcgctttcgacaacgagcacgtcgtgctgcccctgacc
aagtacgaccacatcatcgaccgtgactcgccccgtcccggtcagcaggccttcgagaag
atgaccgccggtctgtacctgggtgagatcttccgtctggccctgatggacctggtggag
aaccgccccggcctcatcttcaacggccaggacaccaccaagctgcgcaagccctacatc
ctggactcctccttcctggcggccatcgaggaggatccctacgagaacctggaggagacc
gaggagctcatggagcgcgaactcaacatcaaggctaccccggcggagctggagatgatc
cgccgcctggccgagctcatcggtacgcgtgccgctcgcctgtcggcctgcggtgttgcc
gccatttgcacgaagaagaagatcgactcgtgccacgttggtgctgacggctccgtcttc
accaagtaccctcactttaaggcacgcggagccaaggctctgcgggagatcctggactgg
gctccggaggagaaggacaaggtgaccatcatggcggccgaggatggatctggtgtggga
gctgcgctgattgcggcgctgaccctgaagcgggtcaaggccggcaacctgtgcggtatc
cggaacatggctgatatgaagaccctgctataa

DBGET integrated database retrieval system