KEGG   Zea mays (maize): 100382914Help
Entry
100382914         CDS       T01088                                 

Definition
uncharacterized LOC100382914
Orthology
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
zma  Zea mays (maize)
Pathway
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    100382914
Enzymes [BR:zma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     100382914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 591 aa AA seqDB search
MAAIPARLHHLVVVILLLVPSLTAAQSRAFEGAPAAYARYLVDAAAMPAVDLYDYIVVGG
GTAGCPLAATLAGPGGGRVLLLERGGAPSEFPALATAGGFVRTLAMADPAPESDAPAQGF
TSEDGVPNVRARVLGGGTAINAGFYSRAHPEWFRRGHAEDAGMTNVWDMPLVNASYEWVE
RQMTFQPAVHGWQAAVRAALLEANVTPWNGFTVDHVTGTKVGATTFDASGRRRSAADLLA
VARPSRLRVAIRGTVTRIITNPVGLAARRGRSPLPTIAAIGVVYQDRLLDQHQALLRPGG
EVILAAGALGSPQLLLLSGIGPAPDLSSLGIPVSADIPDVGKHMYDNPRNGISFIPSVPI
DHSLIQVVGIPSANGTASYLEAASYIVPVAPALRSSVPFLGSSSPLYVTVATIMEKVPGP
LSEGSLWLSSTNPLESPALRFNYLSRPEDLARCVLGVRHVARVLEGRALDGFRSAVVGST
TTGRRGSSVRREFRIAGTALPADWRTNDRALASYCQQTVATLWHYHGGCVAGKVVDGSFR
VIGSHAIRVVDASTFSETPGTNPQATILMMGRYVGLKMIEERHSRRPVMPP
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggccgccatccccgcgcggctccaccacctcgtcgtcgtcatcctcctcctcgtgccg
tccctcaccgctgctcagtcccgcgcattcgaaggggcgccggcggcgtacgcgcggtac
ctggtcgacgcggcggcgatgccggcggtggacctgtacgactacatcgtcgtgggcggc
ggcacggcgggctgcccgctggcggcgacgctggcgggcccggggggcgggcgcgtgctg
ctgctcgagcgcggcggcgcgcccagcgagttccccgcgctcgccacggcgggcgggttc
gtcaggacgctcgccatggcggacccggccccggagtccgacgcgcccgcgcaggggttc
acgtcggaggacggcgtccccaacgtgcgcgcgcgcgtgctcggcggcggcacggccatc
aacgccgggttctactcccgcgcgcacccggaatggtttcgtcgcggccacgccgaggat
gccgggatgacgaatgtttgggatatgccgctggtgaacgcgtcatacgagtgggtggag
aggcagatgacgttccagccggcggtgcacgggtggcaggcggcggtgagggcggcgctg
ctggaagccaatgtgacgccgtggaacggcttcactgtggaccacgtcaccggcacaaag
gtcggcgccacgaccttcgacgcgtcaggccgacggcgcagcgccgcggacctcctcgcc
gttgcccgtcctagccgcctccgcgttgccatccgtggcacggttactcgcatcatcacc
aacccggttggccttgctgcacgccgtggaaggtctccactaccaacaatcgcagcaatc
ggcgtcgtgtaccaggaccgtctcctggaccagcaccaagccctcctgcgcccaggtggg
gaggtgatacttgccgcaggcgccctggggagcccccagctgctgctgctcagcggcatc
ggccccgctcccgatctctccagcctcggcatccctgtctccgccgacatccccgacgtc
ggcaagcacatgtacgacaaccctcgcaacggcatctccttcatcccgtcggttcccatc
gaccactctctgatccaggtcgtcggcatcccgtcggccaacgggaccgcctcctacctc
gaggcggcgtcgtacatcgtcccggtcgctccggcgctgagatcctccgtccctttcctt
ggctcgtcctccccgctctacgtcaccgtcgcgaccatcatggagaaggttcccggaccc
ttatccgaaggttcgctgtggctctcgtcgacgaacccgctggagagccccgccctgcgc
ttcaactacctgagccgtcccgaggacctggcgcggtgcgttctgggcgtgcgccatgtg
gcgcgagtgctcgagggcagagcgttggacgggttccgttcggcggttgttgggtcgacg
acgacgggtaggagagggtcgtctgtccggagggaattcaggatcgccgggacagcgctg
ccggctgactggagaacgaacgatagagctctggcgagctactgccagcagactgtggcg
acgttgtggcactatcacggagggtgtgtcgccgggaaggtggtcgatgggagttttcgg
gtgattggttcccacgcgattcgcgtggtggatgcgtccacgttcagcgagacgcccggg
acgaatcctcaggccacaatactgatgatgggcaggtatgtggggctgaagatgattgag
gagagacacagtagaaggccggtcatgccgccatag

DBGET integrated database retrieval system