KEGG   Zea mays (maize): 100382931Help
Entry
100382931         CDS       T01088                                 

Definition
uncharacterized LOC100382931
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
zma  Zea mays (maize)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100382931
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100382931
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100382931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 344 aa AA seqDB search
MMLAARLSRPLSQLPGKALSVCDRENGTRHTLLFYPASFSPDTRRTYTSQADAASGKAVL
VTGCDSGFGFSLAKHLHSKGFLVFAGCLLKDKGDAGVRELDSLKSDRLRTIQLNVCNSEE
VEKAVETVRSGLKDPEKGMWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRTTKSF
LPLLRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMHPLGVKVSVVEPG
NFIAATSLYSPERIQAIAKKMWDELPEVVRKDYGKKYFDEKIAKMETYCNSGSTDTSSVI
NAVTHALTAATPYTRYHPMDYYWWLRMQVMTHFPGAISDKIYIH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggccgcccgtctttccagacccctgtcacagctcccaggaaaagctctaagt
gtctgtgatagagaaaatgggacaagacacacactgttgttttacccagcttctttcagc
cctgacacccgtcggacctacaccagtcaggcagatgcggctagtggcaaagctgtcctg
gttacaggctgtgactctggatttgggttctctttggccaagcatctacactcaaaaggt
ttccttgtatttgctggatgtttgttgaaggacaaaggcgatgctggggtcagggagctg
gacagcctgaagagtgaccggctgagaaccatccagctcaatgtctgcaacagtgaggag
gtggagaaagcggtggagaccgtccgctccggcctgaaggatcctgagaagggaatgtgg
ggcctggttaacaacgcaggcatctcaacgtttggggaggtggagttcactagcatggag
acgtataaggaggtggccgaagtgaacctctggggaactgtgcgcacaacaaaatccttc
cttccccttctccgaagagccaaaggccgtgttgttaacatcagcagcatgctgggtcgc
atggccaacccagcccgctcaccatactgcatcaccaagtttggggtagaggctttctcg
gactgcctacgctatgagatgcaccctctgggtgtgaaggtcagtgtggtggagcctggc
aacttcatagctgccaccagcctctatagccctgagcgtatccaggccattgccaagaag
atgtgggatgagctgccagaggtcgtccgcaaagactatggcaagaagtacttcgatgaa
aagattgccaagatggagacctactgcaacagcggttccaccgatacgtcctccgtcatc
aacgctgtcacccatgccctgactgctgccaccccttatacccgctaccatcccatggac
tactactggtggctgcggatgcaggtcatgacccattttcctggagccatctctgacaag
atctacatacactga

DBGET integrated database retrieval system