KEGG   Zea mays (maize): 100382931Help
Entry
100382931         CDS       T01088                                 

Definition
uncharacterized LOC100382931
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
zma  Zea mays (maize)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:zma00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:zma00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 344 aa AA seqDB search
MMLAARLSRPLSQLPGKALSVCDRENGTRHTLLFYPASFSPDTRRTYTSQADAASGKAVL
VTGCDSGFGFSLAKHLHSKGFLVFAGCLLKDKGDAGVRELDSLKSDRLRTIQLNVCNSEE
VEKAVETVRSGLKDPEKGMWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRTTKSF
LPLLRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMHPLGVKVSVVEPG
NFIAATSLYSPERIQAIAKKMWDELPEVVRKDYGKKYFDEKIAKMETYCNSGSTDTSSVI
NAVTHALTAATPYTRYHPMDYYWWLRMQVMTHFPGAISDKIYIH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggccgcccgtctttccagacccctgtcacagctcccaggaaaagctctaagt
gtctgtgatagagaaaatgggacaagacacacactgttgttttacccagcttctttcagc
cctgacacccgtcggacctacaccagtcaggcagatgcggctagtggcaaagctgtcctg
gttacaggctgtgactctggatttgggttctctttggccaagcatctacactcaaaaggt
ttccttgtatttgctggatgtttgttgaaggacaaaggcgatgctggggtcagggagctg
gacagcctgaagagtgaccggctgagaaccatccagctcaatgtctgcaacagtgaggag
gtggagaaagcggtggagaccgtccgctccggcctgaaggatcctgagaagggaatgtgg
ggcctggttaacaacgcaggcatctcaacgtttggggaggtggagttcactagcatggag
acgtataaggaggtggccgaagtgaacctctggggaactgtgcgcacaacaaaatccttc
cttccccttctccgaagagccaaaggccgtgttgttaacatcagcagcatgctgggtcgc
atggccaacccagcccgctcaccatactgcatcaccaagtttggggtagaggctttctcg
gactgcctacgctatgagatgcaccctctgggtgtgaaggtcagtgtggtggagcctggc
aacttcatagctgccaccagcctctatagccctgagcgtatccaggccattgccaagaag
atgtgggatgagctgccagaggtcgtccgcaaagactatggcaagaagtacttcgatgaa
aagattgccaagatggagacctactgcaacagcggttccaccgatacgtcctccgtcatc
aacgctgtcacccatgccctgactgctgccaccccttatacccgctaccatcccatggac
tactactggtggctgcggatgcaggtcatgacccattttcctggagccatctctgacaag
atctacatacactga

DBGET integrated database retrieval system