KEGG   Zea mays (maize): 100383086Help
Entry
100383086         CDS       T01088                                 

Gene name
pco107820(625)
Definition
LOC100383086
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100383086 (pco107820(625))
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100383086 (pco107820(625))
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100383086 (pco107820(625))
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 795 aa AA seqDB search
MDLLRSHLHKVRIPEPTNRIHKDECCVSFDTPRSEGGLYVDMVSFLGFGREYVEWNFEKT
GNPVYLHIVQRRKPEPDEADRPLKKPTLLAIGVEGGFGDQEPEYDETFEIVILPDFICLP
FPSVDLPEKVRLAVDKVLLAESADRKEQLAAWVADKKNISAYAMDLQQLDNGVIVPPTGW
KCSKCDKTENLWLNLTDGMILCGRKLWDGSGGNNHAIEHYEQTKYPLAVKLGTITADLEA
ADVFSYPEDDSVEDPLLAQHLSHFGIDFSSLQKTEMTTAERELDANTNYDWNRIQESGKD
AELLFGPGYTGLANLGNSCYMASIMQVMFSIHPFISRYFEKQSLKAAFATAPADPTVDLN
MQLTKLAHGLLSGKYSAPAKEGQEGIRSRMFKSVITANHPEFSSMRQQDVLEFFLHLIDR
VEKANPGDRELNPFSGFKFVVEERVQCPSGKVSYNKRSDNVLSLSIPLHEATNKEQLEAF
NEKKAAMNLDGKEVSNEDIVRPRVPLEACLSSFSGPEEIPDFYSTALNSKTTVTKTAGFT
TFPDYLVLHMRKFVMETGWVPKKLDVYIDVPDTIDITHMRSKGLQPGEELLPEGGSGDDS
AEPANPVASEDIVTQLASMGFNYLHCQKAAINTSNTGVEEAMNWLLSHMDDPDINDPISK
DSRAYEPSVDEASVQTLISFGFQEDIAIKALKASGGNIEKATDWIFSHPEASTSASADSS
TSNVNADDTYIPDGSGRYKLMAFVSHMGTSTHCGHYVAHVLKDGRWTIFNDSKVAVSVDL
PKEMGYLYFFQRISN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggatctccttcgctctcatctccacaaggtccggatccccgagccaaccaaccgcatc
cacaaggacgagtgctgcgtctccttcgacactccgaggtcagagggaggcctgtacgtg
gacatggtctcgttcctggggttcgggagggagtacgtggagtggaacttcgagaagacg
gggaaccccgtgtacctccacatcgttcagcgccggaagccggagcccgacgaggcggat
cgcccgcttaagaagcccaccctcctcgctataggtgtggaaggaggttttggtgatcaa
gaaccagaatatgatgaaacttttgaaatagtcatcttacctgattttatttgtcttcca
tttccgtcagttgatttgccagagaaggttaggcttgcggttgataaagttttacttgct
gaaagtgctgatagaaaagaacaactggctgcttgggttgctgacaaaaagaacattagt
gcatatgctatggacctgcagcagctagacaatggtgttattgtgcctcctactggatgg
aagtgtagcaaatgcgataaaactgagaacctctggctgaatttaactgatggtatgatc
ctttgtgggaggaagctctgggatggaagtggtgggaataatcatgccattgaacattat
gaacagactaaataccctcttgcggtgaagcttggaacaattactgctgatttggaagcg
gcagatgttttctcgtaccctgaagatgatagtgttgaagatccgctattagctcagcac
ttatcacattttggtatcgatttttcttcactccaaaagactgagatgactactgctgag
agggaacttgatgctaacacaaattatgactggaatagaatacaagaaagtggaaaagac
gctgagcttctgtttggacccggctatactggtcttgcgaatcttgggaatagttgctat
atggcttcaataatgcaagtcatgttttcaatccatcctttcatatcaaggtacttcgag
aaacagagtttgaaagctgcatttgcaactgcacccgctgatccaacagtagacctaaac
atgcaactgacaaaactagcgcatggtttgctctctggtaaatattctgctccagcaaag
gaggggcaagaagggatacgttctcgcatgtttaagtcagttatcactgcgaaccatcct
gaattttcaagcatgagacaacaggatgtccttgaattcttccttcaccttattgacaga
gttgagaaggcaaaccctggagaccgtgagctaaatcctttttccggtttcaagtttgtt
gttgaagagagggttcagtgcccttctgggaaggtttcttacaacaaacgatctgacaac
gttctttctttgagcataccactgcatgaggcaactaataaagagcagctagaagctttt
aatgagaagaaagctgcaatgaacttggatggaaaagaagtgtctaatgaggatattgtc
aggcctagagtcccattggaggcatgcttgtcaagtttttcagggccagaggagattcca
gatttttatagcactgcattaaattcaaagactaccgtcactaagacagctggtttcact
acctttcctgattaccttgtgctgcacatgcgtaagtttgtaatggaaacaggatgggtg
ccaaagaaactcgatgtttatatagatgtgccagatacaattgatatcacacatatgcgc
agcaaaggattacagcctggggaagagctgctacctgaaggaggttctggtgacgacagt
gccgagcctgctaatcctgttgccagtgaggatattgtaacccagcttgcaagcatgggc
ttcaactaccttcattgtcagaaagctgctattaacacatcaaacacaggagttgaggaa
gcgatgaattggctcctctcgcacatggatgatccagatataaacgacccaatatcaaaa
gattcacgtgcttatgagccatctgttgacgaagcaagtgttcaaactctcatctccttt
ggattccaggaagacattgccataaaggccctgaaagcttctggtggtaatatcgagaaa
gctacagactggattttcagccaccccgaagcatctacctcagcatctgctgattcttcc
actagcaatgtaaatgctgatgacacatatattccagatggaagtggcagatacaagctg
atggcgttcgtgagccatatgggcacctctacccactgcgggcactacgtagctcatgtc
ctcaaagacgggaggtggacaatctttaacgacagcaaggtcgcagtatctgttgacctg
cccaaggaaatgggctacctctatttctttcagaggattagcaactag

DBGET integrated database retrieval system