KEGG   Zea mays (maize): 100383086Help
Entry
100383086         CDS       T01088                                 

Gene name
pco107820(625)
Definition
LOC100383086
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 795 aa AA seqDB search
MDLLRSHLHKVRIPEPTNRIHKDECCVSFDTPRSEGGLYVDMVSFLGFGREYVEWNFEKT
GNPVYLHIVQRRKPEPDEADRPLKKPTLLAIGVEGGFGDQEPEYDETFEIVILPDFICLP
FPSVDLPEKVRLAVDKVLLAESADRKEQLAAWVADKKNISAYAMDLQQLDNGVIVPPTGW
KCSKCDKTENLWLNLTDGMILCGRKLWDGSGGNNHAIEHYEQTKYPLAVKLGTITADLEA
ADVFSYPEDDSVEDPLLAQHLSHFGIDFSSLQKTEMTTAERELDANTNYDWNRIQESGKD
AELLFGPGYTGLANLGNSCYMASIMQVMFSIHPFISRYFEKQSLKAAFATAPADPTVDLN
MQLTKLAHGLLSGKYSAPAKEGQEGIRSRMFKSVITANHPEFSSMRQQDVLEFFLHLIDR
VEKANPGDRELNPFSGFKFVVEERVQCPSGKVSYNKRSDNVLSLSIPLHEATNKEQLEAF
NEKKAAMNLDGKEVSNEDIVRPRVPLEACLSSFSGPEEIPDFYSTALNSKTTVTKTAGFT
TFPDYLVLHMRKFVMETGWVPKKLDVYIDVPDTIDITHMRSKGLQPGEELLPEGGSGDDS
AEPANPVASEDIVTQLASMGFNYLHCQKAAINTSNTGVEEAMNWLLSHMDDPDINDPISK
DSRAYEPSVDEASVQTLISFGFQEDIAIKALKASGGNIEKATDWIFSHPEASTSASADSS
TSNVNADDTYIPDGSGRYKLMAFVSHMGTSTHCGHYVAHVLKDGRWTIFNDSKVAVSVDL
PKEMGYLYFFQRISN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggatctccttcgctctcatctccacaaggtccggatccccgagccaaccaaccgcatc
cacaaggacgagtgctgcgtctccttcgacactccgaggtcagagggaggcctgtacgtg
gacatggtctcgttcctggggttcgggagggagtacgtggagtggaacttcgagaagacg
gggaaccccgtgtacctccacatcgttcagcgccggaagccggagcccgacgaggcggat
cgcccgcttaagaagcccaccctcctcgctataggtgtggaaggaggttttggtgatcaa
gaaccagaatatgatgaaacttttgaaatagtcatcttacctgattttatttgtcttcca
tttccgtcagttgatttgccagagaaggttaggcttgcggttgataaagttttacttgct
gaaagtgctgatagaaaagaacaactggctgcttgggttgctgacaaaaagaacattagt
gcatatgctatggacctgcagcagctagacaatggtgttattgtgcctcctactggatgg
aagtgtagcaaatgcgataaaactgagaacctctggctgaatttaactgatggtatgatc
ctttgtgggaggaagctctgggatggaagtggtgggaataatcatgccattgaacattat
gaacagactaaataccctcttgcggtgaagcttggaacaattactgctgatttggaagcg
gcagatgttttctcgtaccctgaagatgatagtgttgaagatccgctattagctcagcac
ttatcacattttggtatcgatttttcttcactccaaaagactgagatgactactgctgag
agggaacttgatgctaacacaaattatgactggaatagaatacaagaaagtggaaaagac
gctgagcttctgtttggacccggctatactggtcttgcgaatcttgggaatagttgctat
atggcttcaataatgcaagtcatgttttcaatccatcctttcatatcaaggtacttcgag
aaacagagtttgaaagctgcatttgcaactgcacccgctgatccaacagtagacctaaac
atgcaactgacaaaactagcgcatggtttgctctctggtaaatattctgctccagcaaag
gaggggcaagaagggatacgttctcgcatgtttaagtcagttatcactgcgaaccatcct
gaattttcaagcatgagacaacaggatgtccttgaattcttccttcaccttattgacaga
gttgagaaggcaaaccctggagaccgtgagctaaatcctttttccggtttcaagtttgtt
gttgaagagagggttcagtgcccttctgggaaggtttcttacaacaaacgatctgacaac
gttctttctttgagcataccactgcatgaggcaactaataaagagcagctagaagctttt
aatgagaagaaagctgcaatgaacttggatggaaaagaagtgtctaatgaggatattgtc
aggcctagagtcccattggaggcatgcttgtcaagtttttcagggccagaggagattcca
gatttttatagcactgcattaaattcaaagactaccgtcactaagacagctggtttcact
acctttcctgattaccttgtgctgcacatgcgtaagtttgtaatggaaacaggatgggtg
ccaaagaaactcgatgtttatatagatgtgccagatacaattgatatcacacatatgcgc
agcaaaggattacagcctggggaagagctgctacctgaaggaggttctggtgacgacagt
gccgagcctgctaatcctgttgccagtgaggatattgtaacccagcttgcaagcatgggc
ttcaactaccttcattgtcagaaagctgctattaacacatcaaacacaggagttgaggaa
gcgatgaattggctcctctcgcacatggatgatccagatataaacgacccaatatcaaaa
gattcacgtgcttatgagccatctgttgacgaagcaagtgttcaaactctcatctccttt
ggattccaggaagacattgccataaaggccctgaaagcttctggtggtaatatcgagaaa
gctacagactggattttcagccaccccgaagcatctacctcagcatctgctgattcttcc
actagcaatgtaaatgctgatgacacatatattccagatggaagtggcagatacaagctg
atggcgttcgtgagccatatgggcacctctacccactgcgggcactacgtagctcatgtc
ctcaaagacgggaggtggacaatctttaacgacagcaaggtcgcagtatctgttgacctg
cccaaggaaatgggctacctctatttctttcagaggattagcaactag

DBGET integrated database retrieval system