KEGG   Zea mays (maize): 100383266Help
Entry
100383266         CDS       T01088                                 

Definition
uncharacterized LOC100383266
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
zma  Zea mays (maize)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100383266
Enzymes [BR:zma01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     100383266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 494 aa AA seqDB search
MEPIVFAGRDPRTGKSHALHRRVEQLCTRAIRWAELKRKTKEDKKLAITVFSFPPDKGNV
GTAAYLNVFSSIYSVLSDLKKDGYNVEGLPDTPEALIEEVIHDKEAQFNSPNLNVAYRMN
VREYQALTSYASLLEENWGKPPGHLNSDGENLLVYGKQYGNVFIGVQPTFGYEGDPMRLL
LSKSASPHHGFAAYYTFVEKIFQADAVLNFGTHGSLEFMPGKQVGMSDACYPDSLIGNIP
NIYYYAANNPSEATVAKRRSYANTISYLTPPAENAGLYKGLKQLAELISSYQSLKDTGRG
PQIVSSIISTAKQCNLDKDVPLPEEGEELPPSERDLIVGKVYAKIMEIESRLPPCGLHVI
GEPPTAIEAVATLVNIAALDRPEDGIISLPGILAATVGRDIEDVYRGSDKGILADVELLR
QITEASRGAITAFVEKTTNSKGQVVNVANNLSNILGFGLSEPWVQYQVHQGRQGEAEGSV
WVPGGVLEARGTGQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggagcccatcgtattcgctggccgggaccccaggacagggaaatcacatgcattgcat
aggagagtggagcagctctgcactagagctatcagatgggcagaactgaagaggaaaact
aaggaggacaagaaactggcgatcaccgtcttcagtttcccacctgacaagggcaacgtc
gggactgcagcatatctgaatgtgttcagctccatctactctgtgctgtcagacctcaag
aaggacggctacaacgtagagggtcttccggacacacctgaagccctcatcgaggaggtg
atccatgacaaggaagctcagttcaacagccccaacctgaatgttgcttaccgcatgaat
gtgagggagtatcaggcgctcacctcctatgcctccttgctggaggagaactgggggaag
ccacctgggcacctcaactctgatggcgagaacctccttgtctatgggaagcagtatggc
aatgtcttcatcggagtgcagcccactttcgggtacgaaggcgatccgatgcggcttctg
ctctcaaagtctgccagccctcaccatggctttgcagcatactacacctttgtcgagaag
atcttccaggccgatgctgtcctgaactttggaacacacgggtccctcgagttcatgcct
ggcaaacaggttgggatgagtgatgcctgctaccctgacagtctcatcggcaacatcccc
aacatctactactacgccgcaaacaacccgtcagaggccacagtcgccaagcgccggagc
tatgcgaacaccatcagctacctgaccccaccggctgagaacgccggcctctacaagggg
ctcaagcagctggcagagctcatctcttcttaccagtctctcaaggacactgggcgtggt
cctcagattgtgagctcaatcatcagcaccgcaaagcaatgcaaccttgacaaggatgtc
ccactgcccgaggaaggggaggagctcccaccaagtgagcgtgacctgatcgttggaaag
gtgtacgccaagatcatggagatagagtcacggctccctccctgcggtctgcatgtgatc
ggcgagccgccaaccgctattgaggcggtggccacactggtgaacatagccgccctcgac
cgccccgaggatggcataatctcgctgcccggcatacttgccgccacagtgggcagggac
attgaagatgtgtacaggggaagcgacaagggcatactggctgacgtcgagctcctgagg
cagataactgaagcttcgcgtggcgccatcactgcctttgttgagaagaccacaaacagc
aaagggcaggtcgtcaatgttgccaacaatctcagtaacatacttggcttcggcctttca
gaaccatgggtgcagtaccaagttcatcagggcagacagggagaagctgagggttctgtt
tgggttcctgggggagtgcttgaagctcgtggtacaggacaatga

DBGET integrated database retrieval system