KEGG   Zea mays (maize): 100383275Help
Entry
100383275         CDS       T01088                                 

Definition
uncharacterized LOC100383275
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
zma  Zea mays (maize)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:zma00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 342 aa AA seqDB search
MQETKHRLHAQEIARSLDLRKYDGIICVSGDGVMVEVVNGLLQREDWETAIKVPLGIVPA
GTGNGMARSLLHAAGEPFSVSNAVFAIIRGHKRALDVTSVVQGNTRFFSVLMLTWGLVAD
VDIESEKYRWMGSARLEFYLLLRMLNLRRYNGRILFVPAPGYEEVGDPVEQTTGHETNGV
SGATDKNGETCGYVGPSIKEADLRWRSLNGPFVSVWLGNVPFASEDAMAAPKAEFADGYL
DAAIIKDCPRWDVLGLVLQMKDGAYVNSPCVEYFKVKAIRIEPGLRVGSSTKGGIIDSDG
EVLARGDGSHSRAGDEPGHLMAYGPPIQLTVDQGLATIFSPR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaccaagcatcggcttcatgctcaagagatcgcacgttcacttgatcttagg
aagtatgatggcatcatttgtgtcagtggagatggtgtgatggtagaggttgtcaatggt
ctcctgcagagggaggactgggaaacagcaataaaagtgccccttgggatcgttccggca
ggtactggaaatggaatggcacgatctctattgcatgctgctggtgaaccattctctgta
tctaatgctgtgtttgcaatcatcagaggtcataaacgtgcacttgatgttacttctgtt
gtgcagggaaacacaaggttctttagtgtcctgatgcttacatggggtctggtggctgat
gttgatattgaatcggagaagtataggtggatgggaagtgctcgccttgaattttatctc
ctactccgcatgctgaacctgcgacggtacaatgggcgcatcctttttgttccagcacca
ggatatgaagaagttggtgatcccgtggaacaaactaccggtcatgaaacaaatggggtt
agcggggcaactgacaaaaatggtgaaacgtgcggctatgtcggcccgtcgatcaaagaa
gccgatcttagatggagatcgctgaacggtccgttcgtttcagtctggctcggcaatgtt
cctttcgctagcgaagatgccatggcagcaccaaaagcagagtttgcggatggctacttg
gatgctgctataatcaaggactgcccgcggtgggatgttctggggctcgtgctccagatg
aaggacggcgcctacgtgaactcgccgtgcgtggagtatttcaaggtgaaggcgatccgg
atcgagccgggcctgcgcgtgggcagcagcaccaagggcggtatcatcgactcggacggg
gaggtgctcgcgaggggcgacgggtcccactcccgcgccggcgacgagccggggcacctg
atggcgtacggcccgcccatccagctgacggtggaccaggggctggccaccatcttctcc
ccgagatga

DBGET integrated database retrieval system